(data stored in ACNUC7421 zone)

EMBL: CP002116.PE132

CP002116.PE132       Location/Qualifiers
FT   CDS_pept        complement(138846..140063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79292"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E8"
FT                   /protein_id="ADK79292.1"
FT                   /translation="METTQTVFAARVYYMQTALEVLADLMTTSEDIDREWRRFSLAAGP
FT                   FSGETKRRVFQTARVGSILTDPESTRAFARRIAPKVDLNIKAVLEHFTTYPWFYTIFEV
FT                   EKIVGDGFLIAKIRDSHEMLFSKPAEAKAREGGGCMLGLLFFNGACFQSWGEVVLLDSF
FT                   FEGDIRFFARTAACREYEEKGIESAIIASPLPFLLLREFSKLPQTLFHGEIARACSSQL
FT                   TLSSDIKCLIDQCRCKRQIIENDRYLRICLGGNLVTNPPTLYLDKKDHSLTLATFTLEG
FT                   YRKARFALLSSVEFPEKPQQAVSSAMQYAVFQLFKVQPYWMSFDATFLADEQDTAPLHC
FT                   LERVVYYRTRNGNLPPPDIVAEESGQDQRSAEIFLHAIQTIWDEAATKKASPGQRECTN
FT                   RRNCAA"
     atggaaacaa ctcaaacagt attcgccgcc cgtgtatact acatgcaaac ggctctggag        60
     gtcctggccg accttatgac cacaagtgag gatatcgacc gtgaatggag gcgtttttcc       120
     cttgccgcag ggcctttttc tggagaaaca aaaagaaggg tatttcagac cgcaagagta       180
     ggaagcattt tgacggatcc agaatctacc agggcttttg caaggcgcat cgcacctaaa       240
     gtcgacctca acataaaggc tgtacttgag cattttacta cgtatccatg gttttatacc       300
     atctttgaag tggaaaaaat agtgggagat ggtttcctta tagccaaaat acgggactcc       360
     cacgaaatgc ttttcagcaa accggcggaa gcaaaagcga gagagggagg aggctgtatg       420
     ttagggcttc tttttttcaa cggcgcatgt ttccagagct ggggtgaagt cgtactactc       480
     gattcttttt tcgaaggcga catccgtttt tttgcccgta ccgcggcatg ccgggaatat       540
     gaagaaaagg gaatagaaag tgcgattatt gcttctcctc tgccttttct attgctcaga       600
     gaattttcta aacttcccca aacgcttttt cacggagaaa ttgccagagc ctgttcctca       660
     caactcacgc tatcatctga tatcaaatgc cttattgatc aatgtcgatg caagcgccaa       720
     ataatagaaa acgacaggta tcttcggatt tgtcttggcg gcaatcttgt aacgaatcca       780
     ccgactcttt atctggataa aaaagaccac tcactcacgc tggcaacgtt taccctcgaa       840
     ggataccgta aagcacgttt tgctcttctt tcctctgtgg aattcccgga aaaaccccag       900
     caagcggtaa gcagtgccat gcaatatgca gtttttcagc ttttcaaggt tcaaccgtac       960
     tggatgagtt ttgatgcaac gttccttgcc gatgaacagg acacagcccc gcttcactgc      1020
     cttgaaaggg tagtgtatta ccgtaccaga aatggcaacc tccccccgcc agacatagta      1080
     gcagaagaaa gtggccaaga ccaacgcagt gcggaaatat ttctacatgc aatacaaacc      1140
     atttgggatg aagccgcaac aaagaaggct tcccccggac agagagaatg cacaaacagg      1200
     agaaattgcg ctgcatag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page