(data stored in ACNUC7421 zone)

EMBL: CP002116.PE134

CP002116.PE134       Location/Qualifiers
FT   CDS_pept        140833..141891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0137"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="InterPro IPR006675:IPR006674; KEGG: sus:Acid_4618
FT                   metal dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: Metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: HD domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79294"
FT                   /db_xref="GOA:E1R8F0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F0"
FT                   /protein_id="ADK79294.1"
FT                   /translation="MDPVECLAEAGHNSAYVLWSALDGYFGSDSSSDYQIACTEATLPQ
FT                   LAGMPGALEFPGSEWADAIWYPADRGRGVMLRCVDALDVAPPSTVIQGRLLRMPGKAWY
FT                   RDPFGCYPLLRNSQLSVDFEDEGSWLDAAEIAIYLSRYDYRLPEKGFGPKRFTGLKLLP
FT                   GEQRMLLMLMLGGEHPDRGLRFLFDCGFIEEHWPLFLSMARTHQSKDFHPEGNVWDHTL
FT                   ATLVHRKKADPELGLALLLHDCGKPSSHRSEGNQFHRHAQIGAAVAVRFLRSLEFDEEV
FT                   IRRIRYLVANHMVPSFLSASPPPAIAEVLDHELFPLLLELFRCDISSSFRGPEPYYQAC
FT                   KLYRNWKRKRRV"
     atggatcctg tcgaatgcct cgccgaggcc ggacataata gtgcctatgt tctctggagc        60
     gccttggatg gctattttgg cagtgatagt tcttccgatt accaaattgc ttgcaccgag       120
     gcaacgcttc cgcagcttgc gggcatgccg ggagctcttg aattccccgg ttcagaatgg       180
     gccgatgcta tctggtatcc ggccgatcga ggccgtggtg ttatgcttcg ttgcgttgat       240
     gcacttgatg ttgctcctcc cagcaccgtg atacagggcc gtttgttacg tatgccgggg       300
     aaggcgtggt atcgagatcc ttttggatgc tatcctctcc ttcgaaattc gcagcttagt       360
     gtggattttg aggatgaggg aagttggctt gatgctgcgg agattgccat ctatctctca       420
     cgatatgatt atcgactgcc cgaaaagggt ttcggtccaa agcgttttac cggtctgaaa       480
     ttgcttccgg gtgagcaacg gatgcttttg atgctgatgc ttggtggtga gcacccagat       540
     agaggcctgc gttttctttt tgactgcggc tttattgaag aacattggcc tctctttctc       600
     agtatggcaa ggacacatca aagcaaggat tttcatccgg aaggtaatgt gtgggaccat       660
     actcttgcca cgcttgtgca ccgaaagaag gcggatcccg agctggggct ggctctttta       720
     ctccatgact gcggaaaacc ctcttctcac cggtcggaag gtaatcaatt tcaccgacat       780
     gcacagatag gagccgctgt tgcggttcgt tttcttcgtt cgcttgagtt cgatgaagaa       840
     gtgatcaggc gtattcgtta tctggtcgca aatcatatgg ttccctcgtt tttgtctgcc       900
     tctccgcctc ctgcgattgc cgaagtactt gaccatgaac tctttccctt gcttcttgaa       960
     ctttttcgct gtgatatttc ttcgtcattt cggggacccg agccctatta tcaggcgtgc      1020
     aagttgtatc gtaattggaa aagaaagcgt agggtttga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page