(data stored in ACNUC7421 zone)

EMBL: CP002116.PE136

CP002116.PE136       Location/Qualifiers
FT   CDS_pept        complement(143261..143803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_018300 zinc finger (CCCH type)
FT                   protein, putative; SPTR: Filamentous haemagglutinin family
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79296"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F2"
FT                   /protein_id="ADK79296.1"
FT                   /translation="MKQSAKQWAVLDRHVSTFYNIMMRRSFHHFFSFFLLLFCFAISFS
FT                   NAQTIAPEIDLKTLYLSVNSSQPPEINQNQTLAIDGTVSAREILQPAEEGFIGLLELTV
FT                   GEWEGLESVEVYRCYVQLEGDRFADMIPAGRTRETSPTEIPLNTKVLVFGTYIGYSEDA
FT                   QGNRYPVLLGNAVRIIR"
     atgaagcaat cagcaaaaca gtgggcagtc cttgaccggc acgtttccac gttctacaat        60
     atcatgatga gacgaagctt tcaccatttt ttttcctttt ttcttctcct tttctgtttt       120
     gcgatttctt tttccaacgc ccaaacgata gctcccgaaa ttgatctgaa aacgctctat       180
     ctttcggtaa atagttcaca gccaccggag attaatcaga atcaaacatt agccatcgat       240
     gggacggtat cggcacgaga aatcctccag cctgcggaag aaggctttat cggcctttta       300
     gagttaaccg taggagaatg ggagggattg gaatcggttg aagtgtaccg ttgctatgtt       360
     cagcttgaag gtgatcgttt tgctgatatg atcccggcag gaagaacgcg agaaacaagt       420
     ccgactgaaa ttccattaaa tacaaaggtt ctcgttttcg gtacgtatat tggatattcc       480
     gaagacgcac aaggcaatcg ttatcctgtc ttattgggaa atgcagtacg aattattcga       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page