(data stored in ACNUC7421 zone)

EMBL: CP002116.PE137

CP002116.PE137       Location/Qualifiers
FT   CDS_pept        143872..144423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0140"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="COGs: COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor); InterPro
FT                   IPR003658:IPR002645; KEGG: tde:TDE2083 anti-anti-sigma
FT                   factor; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; SPTR: Anti-sigma factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: STAS domain;
FT                   TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79297"
FT                   /db_xref="GOA:E1R8F3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F3"
FT                   /protein_id="ADK79297.1"
FT                   /translation="MNNNDIVPGFDDEKDDSLKIRLQKVDDVEGCLVLYLTGYIDTYNS
FT                   NFFQKRVTKAVEHNFTRLIFNCGGLNYVSSTGIGSFTAFLKAVKPRGGDLVLLEIQPKV
FT                   YEVFQLLGFSQFFNIKDNLNEAVEFFSSEGKSGATDVFPKIFQCPICSKKLKATKSGRF
FT                   RCSECKTILAIDNAGQVFLG"
     atgaataata acgatattgt acccggattc gatgatgaaa aagacgatag tcttaaaata        60
     cggctgcaga aggtggatga tgttgaaggg tgcctggttc tctatctgac cggctatatt       120
     gatacctaca attccaactt ctttcagaaa cgggtaacga aagcagttga gcacaatttt       180
     accaggctga ttttcaactg tggcggactt aactatgttt ccagtaccgg tattggatct       240
     ttcactgctt tccttaaggc ggtaaagcct cgaggggggg atttggttct gctggagatc       300
     cagccgaagg tctatgaggt atttcagctg cttgggttca gccagttttt caatattaaa       360
     gataatctaa atgaagccgt cgaattcttt tcttcggaag ggaagagtgg tgcgacggat       420
     gtcttcccca agattttcca atgtcctatt tgcagtaaaa agctcaaggc gacaaaatcc       480
     ggaagattcc gctgtagcga atgtaagacg attcttgcca tcgataacgc ggggcaagtc       540
     tttctgggat ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page