(data stored in ACNUC7421 zone)

EMBL: CP002116.PE138

CP002116.PE138       Location/Qualifiers
FT   CDS_pept        144429..144800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5471 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79298"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F4"
FT                   /protein_id="ADK79298.1"
FT                   /translation="MNAVERYLLNLDLNYEEVAAKTYIIHEPEKGLENVAVMLDEPLVI
FT                   VQVKVMDVPSSGRERFFRTLLNLNATDLIHGAYGVNGDEVILIDTLRSATMDLEEFQAC
FT                   LDAIGLALSQHYRILSDFR"
     atgaacgcag tggagcgtta ccttctaaat cttgatctga attatgaaga ggttgctgca        60
     aaaacctata ttattcatga gcccgaaaag ggacttgaga atgttgcggt tatgcttgat       120
     gaacccttgg tgattgtgca ggttaaggtg atggatgttc cgtcttccgg ccgggaacga       180
     tttttcagga cattattaaa cctcaacgca accgatttga tccatggcgc ctacggtgtc       240
     aacggggacg aggttattct gatagacacc cttcgttcgg ctaccatgga tctcgaagaa       300
     tttcaggcct gtcttgatgc gatcggtctg gctctttcgc agcattaccg aattctgtcg       360
     gatttccgat aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page