(data stored in ACNUC7421 zone)

EMBL: CP002116.PE139

CP002116.PE139       Location/Qualifiers
FT   CDS_pept        144822..145508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0142"
FT                   /product="phage shock protein A, PspA"
FT                   /note="COGs: COG1842 Phage shock protein A (IM30)
FT                   suppresses sigma54-dependent transcription; InterPro
FT                   IPR007157; KEGG: hoh:Hoch_0487 phage shock protein A, PspA;
FT                   PFAM: PspA/IM30 family protein; SPTR: Phage shock protein
FT                   A, PspA; PFAM: PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79299"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F5"
FT                   /protein_id="ADK79299.1"
FT                   /translation="MGFFQRFRRMIKSNLNEMISKAEDPEKMLDQVIVDMNRQMIESKK
FT                   SVAGAIADEKKLERQLNQTIAAAREWEEKAKLAVRAGKDDLAKEALLRKQEYMGEAAQY
FT                   REQLEGQHDSVEKLKQSLRQLQQKIDEAQRKRNLLIARAKRAKAQQKMQETIKGINQNS
FT                   AFEAFDRLSEKVDRMEAENEAYEELDAPVKDDLERQFEALEDGSGTSADLLLEDLKQRM
FT                   KHEEPS"
     atggggttct tccaacgatt cagacgaatg attaaatcta atctgaacga aatgatcagc        60
     aaggccgaag atccggaaaa aatgcttgat caggttatcg tcgatatgaa tcggcagatg       120
     atcgagtcga aaaaaagtgt tgccggtgcc attgccgatg aaaagaagct tgagcgccaa       180
     ttgaatcaaa ccattgctgc cgctagggaa tgggaagaaa aagcaaagct tgcggtacgg       240
     gcagggaaag acgatctcgc taaggaagct cttttacgga agcaggagta tatgggagag       300
     gccgcccagt atcgggagca acttgaggga cagcatgact cggtggagaa gctgaagcag       360
     agccttcgcc agcttcaaca aaaaatcgac gaagcccaga gaaaaagaaa tcttctgatt       420
     gccagggcaa agcgagccaa ggctcagcaa aaaatgcagg agactatcaa gggcattaat       480
     cagaacagtg cctttgaagc gtttgatcga ctcagcgaaa aggtcgaccg tatggaggcc       540
     gagaacgaag cgtatgaaga attggatgcc ccggtcaagg atgatttgga gcgtcagttt       600
     gaagccttgg aagacggtag cggcacgagc gccgacctgt tgctggagga tcttaagcag       660
     cggatgaagc atgaagaacc atcgtaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page