(data stored in ACNUC7421 zone)

EMBL: CP002116.PE14

CP002116.PE14        Location/Qualifiers
FT   CDS_pept        11411..11728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0014"
FT                   /product="ferredoxin"
FT                   /note="COGs: COG0633 Ferredoxin; InterPro IPR001041; KEGG:
FT                   lic:LIC12506 adenylate/guanylate cyclase; PFAM: ferredoxin;
FT                   SPTR: Adenylate cyclase; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79174"
FT                   /db_xref="GOA:E1R6P2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P2"
FT                   /protein_id="ADK79174.1"
FT                   /translation="MATLIVEGYDRLITASPAISLLNTLLREGIPISHLCGGKAQCGTC
FT                   RVKILDGESFCSPMGERERLRLSGKEGTLPESVRLACQTYIRGRVVVRILASGRSLDKK
FT                   E"
     atggcaacac ttatcgtaga aggatacgac aggcttatta ccgcaagccc ggcaatttct        60
     ttgcttaata ccctgcttag ggaaggtatc ccaatttccc acctctgcgg aggaaaggcc       120
     caatgtggta cctgcagggt gaaaatcctt gacggggagt ctttttgtag tccgatgggt       180
     gagagggaac gtctgcgcct ttccggaaaa gagggaacac ttccggagtc tgtccggctt       240
     gcatgccaaa cctatatcag aggcagggtt gtggtacgga tactcgcctc cggtcgttcc       300
     cttgacaaaa aagaatag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page