(data stored in ACNUC7421 zone)

EMBL: CP002116.PE140

CP002116.PE140       Location/Qualifiers
FT   CDS_pept        145492..146151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0143"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001867; KEGG: aco:Amico_1683 two
FT                   component transcriptional regulator, winged helix family;
FT                   PFAM: transcriptional regulator domain protein; SPTR: Two
FT                   component transcriptional regulator, winged helix family;
FT                   PFAM: Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79300"
FT                   /db_xref="GOA:E1R8F6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F6"
FT                   /protein_id="ADK79300.1"
FT                   /translation="MKNHRNNNSFRFVAAGIDSGIRMRLKEATIIDSRFRLKEIDHFTI
FT                   PLEYDGPVILFSTFGVLSSPMLNEIMERGFPLIVSGPASSLLRAFELGVADYLREPWSV
FT                   EELLARCGRIASRFPIPVSDGLLTITSEGITGPGGSVDLSAAEGKLLRLLCSVPGRLVG
FT                   RMELALRVGLENRSRALDVHICHLRKKLVQAVPAWANAHRGPIICERAKGYRFIPS"
     atgaagaacc atcgtaataa taactctttt cgttttgtcg cagcgggaat tgatagtgga        60
     attcgtatgc gcctaaagga ggcgaccatt attgattccc gtttccgttt gaaagaaatc       120
     gatcatttta ctattcctct cgaatacgat ggtcccgtta ttcttttttc tacctttgga       180
     gttctcagca gtcctatgtt gaatgaaatt atggaaaggg gatttccatt gattgtttcg       240
     gggcctgctt cttcgctgct gcgggctttt gagttgggcg ttgccgatta cctgagagag       300
     ccttggtcgg tagaagagct tttggctcgc tgtggtcgga ttgcctctcg tttccccatt       360
     cccgtctccg acggtctttt gaccattacg agcgagggta taaccggtcc cggcggtagt       420
     gtcgatctca gtgcagcgga agggaagttg cttcggctgc tgtgtagcgt accgggacga       480
     ttggttggta ggatggaact tgcattaaga gtagggcttg agaataggtc gagagccttg       540
     gatgttcaca tttgtcatct gcggaaaaag cttgttcagg ccgttcctgc ttgggcaaat       600
     gcgcatcggg gcccgattat ttgtgagcgg gcaaagggtt accggtttat cccctcgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page