(data stored in ACNUC7421 zone)

EMBL: CP002116.PE142

CP002116.PE142       Location/Qualifiers
FT   CDS_pept        147408..149150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0145"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019734:IPR013026; KEGG: tde:TDE0867
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79302"
FT                   /db_xref="GOA:E1R8F8"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F8"
FT                   /protein_id="ADK79302.1"
FT                   /translation="MSKSATGRWLFVLVLFWLIAFGVAFGYAFFTFPADHILPLFRLPW
FT                   SFYTGFDLWIDFLPAVTSASMLLSFSFFFPTIASSNSGKISFFGRIFPGVMAWGIVFTL
FT                   LYVIGAELILPSLTERREDIAYQSERAGEWARQGAAAEALADFSEAYDAYKRALAIDLD
FT                   NPLLVEDLERVEGQIPLAEQGSPPSFIESKTGPTRQELEMQASDALVLAKKAYEDEDYF
FT                   TAHYWALLAARWDPEQKPTAMGIAGRSWEAIGKLSPGQRDEERFGRFAKKIAGYQALEQ
FT                   GDVIEAYQTFLELAGDSEAKSDPDIVEFLERSREAVADVSYSAELAIQAEAMPGVPDLL
FT                   FRDSSNGPFIAAGKMVSIEGKSFLLHLELLALDDDGKQLVHITAPAAQFHGKTLLLRGI
FT                   DPNSGRIVDIPEELFAQRRLYRGNGWMLDLDRGLLALSSDQREIADFGSQSHDLGVSNA
FT                   AALFRSSIRESRHGYFRFPGQLELLFRGSMPFLFLNIMIFSVGLGHFFRFRGERIPIFG
FT                   FLFVPFVPFLMKWAIDLFSYAMRLVTALLLFSVSFSLAFAAMLVFHGIMLFVVLLFSAG
FT                   QRDA"
     atgagtaaat cggcaacggg aaggtggctt tttgtacttg tgctgttttg gcttatcgct        60
     tttggagttg ctttcgggta cgcatttttt acctttcctg ccgatcacat tctgccgctt       120
     ttccggctgc catggagttt ttataccggc tttgatctct ggattgattt cttacccgcc       180
     gttacctcgg cctccatgct gctctcgttc tcttttttct ttcccacaat agcttcttcg       240
     aattccggaa agataagctt tttcggacgt atctttccag gagtaatggc ctgggggatt       300
     gtttttaccc tgctatatgt gatcggggcc gagctgatcc ttccttcctt aacagaacgg       360
     agggaagata ttgcgtatca gagtgagagg gccggagaat gggcacggca gggggctgct       420
     gcggaggctc ttgccgattt ttccgaagca tatgacgctt ataaaagagc tctcgccatc       480
     gaccttgata atcctcttct tgtcgaagat ctggaacggg ttgaggggca gatccccctt       540
     gccgaacaag gctctcctcc ctcttttata gaaagtaaaa ccggcccgac gaggcaggag       600
     cttgagatgc aggcctccga tgcgcttgtg cttgcgaaaa aggcctatga ggacgaggat       660
     tattttaccg cccattattg ggcacttctt gccgcgagat gggatcccga gcaaaaacct       720
     acggcaatgg ggatagcagg acgttcctgg gaggctattg ggaaactttc tcccggccaa       780
     cgggatgaag aacggttcgg tcgatttgcc aagaaaattg caggatacca ggctctcgaa       840
     cagggtgatg tgattgaagc atatcagaca tttcttgaac ttgctggaga ttctgaagca       900
     aaatccgatc ccgatattgt cgaatttctg gagcgtagtc gggaggctgt cgctgatgtt       960
     tcctattcgg cggaattggc gattcaggcc gaagcgatgc ctggtgttcc cgatcttctg      1020
     ttccgcgatt cttcaaacgg tccctttatt gctgcgggaa agatggtatc catcgagggg      1080
     aaatcctttc tgctccattt ggagctactg gcattggatg atgacggaaa acagttagtg      1140
     catatcacgg cccctgccgc gcagtttcat ggaaaaaccc ttttgctcag aggcattgat      1200
     ccgaacagtg gtaggattgt agatattcca gaagaactct ttgcgcagag gcggctctac      1260
     cgtggtaatg gctggatgct ggaccttgat cgtggccttc tggcactatc ttccgatcag      1320
     cgtgaaatag ccgatttcgg gtctcaaagt cacgacttgg gtgtgagcaa tgccgccgcg      1380
     ctgtttcgct cctcgatccg tgagagccgt cacggatact ttcgatttcc cgggcagctt      1440
     gagcttctct tccgcgggtc tatgcccttt ttgttcctga atataatgat cttttccgta      1500
     ggattgggcc atttcttccg gtttcggggg gaacgtatcc ctattttcgg ctttcttttt      1560
     gttcccttcg tgcctttcct gatgaaatgg gccattgatc tgttctcata tgccatgagg      1620
     cttgtaacgg cattattgct attttccgtt tctttttctc ttgcctttgc cgcaatgctg      1680
     gtttttcacg ggataatgct cttcgtggtt ttgctttttt ctgctggtca acgtgatgcc      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page