(data stored in ACNUC7421 zone)

EMBL: CP002116.PE143

CP002116.PE143       Location/Qualifiers
FT   CDS_pept        149143..149604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0146"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="InterPro IPR001623; KEGG: tau:Tola_2364 heat shock
FT                   protein DnaJ domain protein; PFAM: heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein; SPTR: Heat shock protein DnaJ domain protein;
FT                   PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79303"
FT                   /db_xref="GOA:E1R8F9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F9"
FT                   /protein_id="ADK79303.1"
FT                   /translation="MPDMRSFGKGVHLAFERYPMEVLIGLLLGVLIGWGVFGSVIGALC
FT                   GYFFRVLRRQLAAERKECNHEGSIPRGALDGEEQEARRRALAEAYRVLGVDSDSEVEAI
FT                   RKVYRSLAASFHPDGMVALTDEQRRDAEEAFLRIRSAWECIARDRGVRP"
     atgcctgata tgcgaagctt tggaaaaggg gttcacttag cctttgaacg ttatccgatg        60
     gaagtgttga tcgggctgtt gcttggggtc ttgattggct ggggtgtgtt cggatcggtt       120
     atcggtgctc tgtgtggata cttttttcgg gttcttcgca gacaactggc ggctgaacgt       180
     aaagaatgta atcatgaagg atcaatccca aggggagcgc ttgatggcga ggagcaagag       240
     gcaagaagac gggccctcgc cgaagcgtat cgggttcttg gggttgattc ggatagcgag       300
     gtcgaagcga tcagaaaggt gtaccgttcg cttgctgcat cttttcaccc cgatggtatg       360
     gtagctctca ccgatgagca gcgaagggac gctgaggaag cctttctgcg tatccgttcc       420
     gcatgggagt gtattgcccg ggatagggga gtccgcccct aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page