(data stored in ACNUC7421 zone)

EMBL: CP002116.PE145

CP002116.PE145       Location/Qualifiers
FT   CDS_pept        complement(150935..152191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0148"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: dse:Dsec_GM19185 GM19185
FT                   gene product from transcript GM19185-RA; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79305"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G1"
FT                   /protein_id="ADK79305.1"
FT                   /translation="MSPQNRFSKILFFSLVLTGILLLGCGSTPKTIKEQPPPSTSSAET
FT                   GLAEHAATKEREGERTISSSQQGEQEATREQEASTDRSEESAAPPKAMSKEQLMLSVIQ
FT                   AAGQRFTPVRRNNGTPLLAIQDIDQNGEDDAFVLTVEQNGQSIFQSDLGNVKRLYQSQA
FT                   KSVNYYLSVYFQIRGKLISMYRIPFGGRMVLDGFRAFHLRENALYPYAVEAAFQNHDGL
FT                   AIEWVIFSSYNQFSLFSMHRSVSIGSFVEDIDEDGLLDIVEWHKGIEEGTGYETFLTWY
FT                   RWNGTNFGEAGATNIVRNLNAFLSLVEEAILTGTPQKLTPYLSRPVELQKSNDLLKRIF
FT                   TPLDENSLESGLDYCDEIVSIIYPPILENPFSLDSSSGKSVPLDLRLICKNSESLLCRM
FT                   EIAISKNPFVAPQYRIIVR"
     gtgagccctc aaaatcggtt ttccaagata cttttttttt cgctggtatt gacgggaata        60
     ctgcttcttg gttgtggaag tacgccaaaa acgataaaag agcagcctcc cccaagcact       120
     tcctctgccg aaacaggcct ggcagaacat gccgcgacga aggaacgtga gggagaaagg       180
     acgatttctt cctcacaaca aggagagcaa gaagcgacaa gggaacagga agcgtccacg       240
     gatcggagcg aagaatctgc agcccctccg aaagcgatga gtaaagagca gttgatgctc       300
     tctgttattc aggctgccgg ccaacgattc accccggtgc gaaggaacaa cggaacgccg       360
     ctgctggcta ttcaggacat agaccaaaac ggagaggatg acgctttcgt tcttacggtg       420
     gagcagaatg gccagtctat ctttcagagt gatcttggaa atgtaaaaag gctctaccag       480
     agccaagcaa agtcggtaaa ctactatctt tccgtgtact ttcaaattag gggcaagctt       540
     atatccatgt accgaattcc tttcggcggg cgcatggtcc tcgatggttt tagggctttt       600
     catcttcggg aaaacgccct ctacccctat gccgtagaag ccgcgtttca aaatcacgac       660
     ggtttagcca tagaatgggt gatcttctca agctacaatc aattttcgct tttttcgatg       720
     cacagatcgg taagcatcgg cagctttgtg gaagatattg atgaagacgg ccttctcgac       780
     atcgtagaat ggcacaaagg gatcgaagaa ggcaccggtt acgaaacctt ccttacctgg       840
     tatcgctgga atggaacaaa cttcggcgaa gcaggggcaa caaatatagt aaggaatctc       900
     aatgccttcc tttccctggt ggaagaagca atcctcaccg gcaccccgca aaagcttacc       960
     ccgtatctct cccggcctgt ggaactgcag aagagcaatg accttctaaa gcgcatattt      1020
     acaccccttg acgaaaacag tctcgaaagt ggtctggatt attgcgatga gattgtctct      1080
     atcatttatc ctcccattct ggaaaatccc ttctctctgg atagcagttc cggcaagagt      1140
     gttcctctcg accttcgatt gatatgtaaa aacagtgaaa gcctcctatg cagaatggaa      1200
     attgccatta gcaaaaaccc ttttgttgcg ccacagtaca ggatcatcgt caggtag         1257
//

If you have problems or comments...

PBIL Back to PBIL home page