(data stored in ACNUC7421 zone)

EMBL: CP002116.PE146

CP002116.PE146       Location/Qualifiers
FT   CDS_pept        152254..152700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0149"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="InterPro IPR007313; KEGG: sfr:Sfri_3664 FxsA
FT                   cytoplasmic membrane protein; PFAM: FxsA cytoplasmic
FT                   membrane protein; SPTR: Membrane protein FxsA (Suppressor
FT                   of F exclusion of phage T7); PFAM: FxsA cytoplasmic
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79306"
FT                   /db_xref="GOA:E1R8G2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G2"
FT                   /protein_id="ADK79306.1"
FT                   /translation="MADVRDYIRLFDTNNVLKWFFLIMLCGLVLVGEAVVLLFAVDRFS
FT                   RYYVLACLTGSAVIGLLLTWPAVHRIVKHIRKDIAEGEFPEHDMERLLGTIASGIFMLI
FT                   PGFVTDCLGLIIFFFGLRRPVGKLIMMKNRDRLFQAYEYLKLYD"
     atggctgatg tacgtgatta cattagattg tttgatacga acaatgtgct taagtggttc        60
     tttcttatca tgctctgcgg ccttgtcctt gtcggagagg cggttgtcct tctttttgct       120
     gtagatcgct ttagccgtta ttatgtgctt gcctgcctga ccggaagtgc cgttatcgga       180
     ctgcttttga cctggccggc cgtgcataga atcgtaaagc atatcaggaa ggacattgca       240
     gagggggaat tccccgaaca tgatatggaa cgtctcttag ggaccattgc ctcgggaatt       300
     ttcatgctca ttcccggctt tgttaccgac tgtctcggac ttattatctt tttcttcggt       360
     ctgcgtcgtc ccgtcggtaa acttatcatg atgaaaaaca gggatcgact ctttcaggcc       420
     tatgagtatc tgaaacttta cgattag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page