(data stored in ACNUC7421 zone)

EMBL: CP002116.PE147

CP002116.PE147       Location/Qualifiers
FT   CDS_pept        complement(152701..153447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0150"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="COGs: COG1922 Teichoic acid biosynthesis protein;
FT                   InterPro IPR004629; KEGG: tde:TDE1876 WecB/TagA/CpsF family
FT                   glycosyl transferase; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF; SPTR: Glycosyl transferase, WecB/TagA/CpsF
FT                   family; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: Glycosyl transferase WecB/TagA/CpsF family;
FT                   TIGRFAM: bacterial polymer biosynthesis proteins,
FT                   WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79307"
FT                   /db_xref="GOA:E1R8G3"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G3"
FT                   /protein_id="ADK79307.1"
FT                   /translation="MNDQNRIQIFGVPVDDIDEERFGETIRRLATDNGKHQIVFLDFRG
FT                   LMRARGKGEYADMIRTASLVVPTSKSILAGARFLKLPVPHRHNPFAFVIKLLGAIEQIG
FT                   GTLYLVGSRPDALQKAFGNVRDSFPGLRLVGRYAGYFRKDIERDVITAIKKAGPTILLA
FT                   GDGLKGKALWLKRHERSFGFGISLFCDGCFKIFSGKRQRISNKSWERNSWWIPAVIIRP
FT                   WRWFSFLRYILYGILLFIEKMRRRNL"
     atgaacgatc aaaaccggat acaaattttc ggtgtccccg tagatgatat tgatgaagaa        60
     cgatttggag aaacaatacg gagactggca accgacaatg gtaaacatca gatagtattt       120
     ctcgattttc ggggcttaat gagggcacgg ggaaaaggtg aatacgcgga tatgattaga       180
     acggcaagtc ttgtcgttcc cacatcgaag tctatccttg ccggtgcacg atttctcaag       240
     ctcccggttc cccaccgtca caatcccttt gccttcgtca tcaaattact tggtgccatc       300
     gaacaaatcg gaggaacact ctatctggta gggagtcgcc ccgatgccct tcagaaggcc       360
     ttcggtaatg ttagagactc ctttcccgga cttcggctgg tcggccgtta tgccggctat       420
     tttcgaaaag atattgaaag ggatgtgatc acagcaatca agaaagcagg gccgaccatc       480
     ctactggcag gcgacgggct gaagggaaaa gccctctggt tgaaacggca cgaaaggtcc       540
     ttcggtttcg gtatcagtct cttctgtgac ggttgcttca agattttcag cggaaaacga       600
     caacgcatct caaataaaag ctgggaacgc aacagttggt ggattcccgc agtaataatt       660
     cgaccgtggc gctggttttc ctttttaagg tacatccttt acggaatttt gctgttcatc       720
     gagaaaatgc gacgaaggaa tctatag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page