(data stored in ACNUC7421 zone)

EMBL: CP002116.PE148

CP002116.PE148       Location/Qualifiers
FT   CDS_pept        complement(153444..154262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0151"
FT                   /product="protein of unknown function DUF558"
FT                   /note="COGs: COG1385 conserved hypothetical protein;
FT                   InterPro IPR006700; KEGG: adg:Adeg_0610 protein of unknown
FT                   function DUF558; PFAM: protein of unknown function DUF558;
FT                   SPTR: RNA methyltransferase family protein; PFAM: RNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, RsmE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79308"
FT                   /db_xref="GOA:E1R8G4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G4"
FT                   /protein_id="ADK79308.1"
FT                   /translation="MRTFVLDDSETKLASGKRFSPAPERAHYLLRVLRLSQGAVFPGQD
FT                   SRGKRYLITLESETPCTLSLRREEEASAREVEACFRELPEQGPDFPPIIFYQAILKGKK
FT                   MDQVIRQATEAGADFIIPVLTDRSVPQFTPGEAEKKQKRWEIIVREAIQQSGATGTTLL
FT                   LPRSLKKVIEDPPMPRPQGGGREVKLFFHERPIANGSLHGYLSGEISSITAAVGPEGGF
FT                   SPKESEMFLQAGFCPLFFSGNILRAETAAIYGLAAIRALVAERDIWRLVQ"
     atgcgtactt tcgttctaga tgatagtgag acgaagcttg cctcaggtaa gcgtttttcc        60
     ccggcccccg agagggccca ttacctgctt cgggtgcttc gtctctcgca gggagcggta       120
     tttccgggcc aggatagccg gggcaaacgc tatcttatca ctcttgaatc ggaaaccccc       180
     tgtaccctca gcctaaggag ggaggaagag gcatctgcaa gggaagtgga ggcgtgtttt       240
     cgtgaacttc ccgaacaagg ccccgatttt cctccgatta tcttctatca ggcgatctta       300
     aaagggaaga agatggatca ggttatccga caggcaacgg aagcgggggc tgatttcatc       360
     ataccggtgc ttaccgaccg ctcggtgccc caatttactc ccggagaagc ggaaaaaaaa       420
     caaaaacggt gggaaataat cgtccgagaa gcgatccaac aaagtggagc cacaggaaca       480
     accctattgc ttccccgttc attaaaaaag gtgatagaag atcctccgat gccgagacct       540
     cagggtggag gaagggaggt taaactcttt tttcacgaac ggcctattgc aaacggttcg       600
     cttcatggat atctttctgg ggagatcagc tcaataacgg cagcggttgg gccggagggg       660
     ggcttttccc cgaaagagag cgagatgttt ttacaagccg gcttttgccc gctctttttt       720
     tccgggaaca tcctcagggc ggaaaccgcc gcaatttatg gcctggcagc tatcagggct       780
     cttgtggctg agcgtgatat atggagattg gtccaatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page