(data stored in ACNUC7421 zone)

EMBL: CP002116.PE149

CP002116.PE149       Location/Qualifiers
FT   CDS_pept        complement(154273..154677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0152"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: hor:Hore_00760 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family UPF0047; TIGRFAM: conserved hypothetical
FT                   protein TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79309"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G5"
FT                   /protein_id="ADK79309.1"
FT                   /translation="MNRWETVLNIKTSGRSDMVDITDKITSAVQESGVRNGICMVYIPH
FT                   TTCAVTINENADPAVKHDIMAELDKIVPWKDAYHHMEGNSAAHIKSSMFGFSQTIPITE
FT                   GALPLGTWQGIYLCEFDGPRSRTVSVQIFG"
     gtgaacagat gggaaacagt tctaaacatc aaaacctcag gtagaagcga tatggtggat        60
     atcaccgaca agataacgtc cgccgtgcag gaaagcgggg tgcgcaacgg catatgcatg       120
     gtatatattc cccataccac ctgtgccgtc accatcaacg agaatgccga tcctgcggtc       180
     aaacatgata ttatggctga actggacaag atagtcccct ggaaggacgc ctatcatcac       240
     atggaaggaa acagcgctgc gcatatcaag tccagtatgt tcggcttctc gcagacaata       300
     ccaattaccg aaggtgctct ccccttgggg acctggcagg ggatctatct ctgcgaattc       360
     gacgggccga ggagcagaac cgtatcagtc caaatctttg gatag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page