(data stored in ACNUC7421 zone)

EMBL: CP002116.PE15

CP002116.PE15        Location/Qualifiers
FT   CDS_pept        11795..12805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0015"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: sth:STH770 LacI family
FT                   transcriptional repressor; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; regulatory protein
FT                   LacI; SMART: regulatory protein LacI; SPTR: LacI family
FT                   transcriptional repressor; PFAM: Bacterial regulatory
FT                   proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79175"
FT                   /db_xref="GOA:E1R6P3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P3"
FT                   /protein_id="ADK79175.1"
FT                   /translation="MKKQTINDVARLSGVGKATVSRVFSGSPLVSEATRERVLETAREI
FT                   GYHPNPVARALTTAKTGNITIVLPSLQSFVMSQIVRGAMFAANKNGYSLFVLDSGEDSD
FT                   KSGADYSDLLHEHASDGVIFCYESARQQMESVSLRRPVLFLESTPTKESLDCIRTDNRT
FT                   GMRLLVEYLFELGHKRIAAVFGRRSPYSENRYIHFIAAMEGVGLPVTEDHLLFSNWAIE
FT                   DGYRDFRSLMGLPFSSRPSAIVFISDFMATGALRAAADMGIAVPDEVSIAGTDDAETSA
FT                   FLIPGLTTLGFDPHGLGEKAVEQLIRRIQYPDEEALHLVVPVTLRKRGSTGPVKW"
     atgaaaaagc aaacgataaa tgatgttgcc cgtctttcgg gagtgggtaa ggctacggtt        60
     tctagggttt tttcaggttc tcctcttgtt tcagaagcca caagggagag ggtgttggag       120
     actgcacgtg aaattggtta tcatcctaat cccgttgcac gtgctctgac taccgcgaag       180
     accgggaata ttaccatcgt ccttccgagc cttcagtcct ttgttatgtc gcagatcgtt       240
     aggggtgcca tgttcgcagc caacaaaaac ggctacagcc tttttgttct tgattcgggt       300
     gaggattcgg ataaatccgg agccgattac tcggacctac tccatgaaca cgccagcgac       360
     ggtgtcatat tctgctatga aagcgcccgt cagcagatgg agtcggtttc attacgtcgt       420
     ccagtgcttt ttctggaaag tactccgaca aaggagagtc tggattgcat acgcacggac       480
     aacaggacag ggatgcggct tttggttgag tatctttttg agctcggaca caagcgcatt       540
     gccgctgttt ttggaaggcg aagtccctac tcggaaaacc gctatatcca ctttattgct       600
     gcaatggaag gcgttggttt accggtaacc gaggatcatc ttttgtttag taattgggcc       660
     attgaagatg gatatcgaga tttccgttct cttatgggcc ttccattttc atctcggccg       720
     agtgctattg tttttatatc ggattttatg gcaaccggtg cacttcgtgc tgcagccgat       780
     atggggattg cggtgccaga tgaggttagt attgccggca ccgacgatgc cgaaacaagt       840
     gcctttctta ttcccgggtt gactaccctt ggttttgacc cccatggact tggggaaaag       900
     gcagtggagc agctgatacg acgaatacaa tatcccgatg aggaggctct gcatcttgtt       960
     gtgccggtta cgttacgaaa acggggttcc accggcccgg tgaaatggta a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page