(data stored in ACNUC7421 zone)

EMBL: CP002116.PE150

CP002116.PE150       Location/Qualifiers
FT   CDS_pept        complement(154674..156176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0153"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR004447:IPR001478:IPR005151; KEGG: bga:BG0359
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Carboxy--processing
FT                   protease; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   Peptidase family S41; PDZ domain (Also known as DHR or
FT                   GLGF); TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79310"
FT                   /db_xref="GOA:E1R8G6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G6"
FT                   /protein_id="ADK79310.1"
FT                   /translation="MKQIRNRLAWLMVAIVTVSFSLFLIITPTLSAQSSSSVEVKNYLA
FT                   RFQYIFQYILQAYVDEVDPKQLYEGALNGMFDTLDDPWSYYLSEDDMEDLNNNTTVGRY
FT                   GGVGLYIARPVPVDEKDKGKVMKIPDQWPELDTTKEDLPFIKVVSPIEDTPAYRKGIHS
FT                   GDYIIAIGDQSTENMTSDDASGKMKGLPGTDVTVTILRGKNIIFDVTITRASIEIPTVK
FT                   EAMIPGRIGYIRIIQFSPYTEPRVREALKTLNSQGYDSLIIDVRGNGGGLLNAAVNIID
FT                   MFLSSGPIVSTKGRIAEENKVFNATSSLEVAADVPIAILIDGGSASASEILAGAFKDTG
FT                   RGYLIGNTSFGKGLVQTVVPLGREGFKLTISRYYTPSGVNINGTGIEPNLKIAEPELND
FT                   EENASLKKLFEEHLVENFVNGNPKPSEQEQKAFARRLQQEEEITLPFDLLMRLIRGEVF
FT                   RRMDQPPVYDLDYDPVLKKAVSLLETGAIQPTTGTLAQEQKQ"
     atgaaacaga tacgaaatag actcgcctgg cttatggtcg ccatcgttac cgtaagcttt        60
     tccttattct taatcatcac ccccaccctt tcggcacaat cgtcgtcatc ggttgaggtg       120
     aaaaactacc ttgccagatt tcagtatatc tttcagtaca ttcttcaggc atacgtcgac       180
     gaggtagatc cgaagcagct ttacgaaggg gccctgaacg gtatgttcga tacccttgac       240
     gacccatggt cctactatct ctccgaagac gacatggaag atctgaacaa caataccacg       300
     gtcggacgat acggcggggt cggcctctat attgcacgac ccgttcccgt cgatgaaaag       360
     gacaaaggaa aggtcatgaa gattcccgat cagtggccag agcttgatac cacgaaagag       420
     gatcttcctt tcataaaggt cgtctctcca atcgaagata ccccggcata ccgaaaggga       480
     attcattccg gggactacat catcgcgatc ggagaccagt cgacggagaa tatgacctcc       540
     gacgatgctt cggggaagat gaaagggctc cccggcaccg atgtaacggt aaccatactg       600
     cggggaaaga atatcatttt cgatgtgaca atcacccgcg caagtatcga aattcccacg       660
     gtaaaagaag caatgattcc cggcaggatc ggctatatac gcatcattca attctccccc       720
     tataccgaac cgagggtcag agaggcctta aagaccctca acagccaggg gtacgactct       780
     ctcattatcg atgtcagagg caatggaggg gggcttctga atgcagcggt taatatcatc       840
     gatatgtttc tctcctccgg ccccatcgtc agcacgaagg gaaggattgc ggaagagaac       900
     aaggtcttta acgcaacctc atcgttggaa gtagccgcag atgtaccgat agcgattctg       960
     atagatggcg gatctgcatc ggcatcggaa attctcgcag gggcgtttaa agatacgggg      1020
     agaggctatc tcatcggaaa tacgagcttt ggaaaggggc tggttcagac ggtggtacct      1080
     ctgggcaggg aagggttcaa gcttaccatc agtcgctatt acacaccatc cggagtaaac      1140
     atcaacggaa cggggatcga accgaacctg aaaatcgcag aaccggagct taacgacgaa      1200
     gaaaatgcat ctctcaagaa acttttcgaa gagcatcttg tggaaaattt cgtgaatgga      1260
     aaccccaaac ccagcgaaca ggaacagaaa gcctttgcca gacggttgca gcaggaagaa      1320
     gaaataacac tccccttcga tttgctgatg cgactgatca ggggtgaggt gttcagaaga      1380
     atggaccagc cgccggtcta cgatcttgat tacgatccgg tgctgaaaaa agccgtttca      1440
     ttactggaga ccggagcaat tcagccaacg acgggaacgc tggctcagga gcagaaacag      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page