(data stored in ACNUC7421 zone)

EMBL: CP002116.PE152

CP002116.PE152       Location/Qualifiers
FT   CDS_pept        156728..157870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0155"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002586; KEGG: tde:TDE1397
FT                   flagellar synthesis regulator FleN, putative; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; SPTR: ATP-binding
FT                   protein; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79312"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G8"
FT                   /protein_id="ADK79312.1"
FT                   /translation="MRILPIASGKGGVGKSLVAANLSIALAQSGKKVVLADLDLGASNL
FT                   HLILGVRAVQQGIGTFLTNAEIEFEEVILPTDYPNLRFIPGDAEIPGMANLKSSQKAKL
FT                   IRKLRTIEADYIIIDLGAGTSYNTLDFFLSSSRGIIVTAPTLTATLNAYLFLKNSVFRL
FT                   MNGAFRKSSPAGKYIENLQREGTPLQRVYIPRLLERIMEEDPDSYKNFARSMANFHPML
FT                   VLNMLEDPEDGKKAARIRRSCKQYLDVDMEHLGVLYFDHLQEIALGSRIPIVAYKPQSV
FT                   LSQGIYRIADKLIQKQDEGESPLDLMSLEESYQVAEMEAEIDFEAKVQDMENLLHSGAL
FT                   TRGDLIDTIRSQQYEISTLKKENQLLKSKLLKAAENGFQI"
     atgcgaatct tgccgattgc aagcggtaaa ggaggcgtcg gcaaatctct tgtcgctgcg        60
     aatctttcca ttgccctcgc ccagtccgga aaaaaagtcg ttcttgctga tttggatctg       120
     ggagcttcga atttgcatct cattctcgga gtgagggccg ttcagcaggg cattgggacg       180
     tttctgacca acgctgagat cgaatttgaa gaggttattc ttcctaccga ttatccaaat       240
     ctacggttta tccccggaga tgctgaaatt cccggtatgg ccaacctgaa aagttctcaa       300
     aaggcaaagt tgattcggaa acttaggaca atcgaagctg actatatcat tatcgacctg       360
     ggcgccggta ctagctacaa tacgctcgat ttttttcttt ccagttctcg agggattatc       420
     gtcaccgcac caaccttgac ggctacgctg aatgcctatc ttttcctgaa aaattccgtt       480
     ttcagactta tgaatggagc tttccgcaag agtagtcctg caggaaagta tattgagaat       540
     cttcaacgcg agggaacgcc gctccagcgg gtgtacatcc cccgattatt ggaacggatc       600
     atggaagagg atcctgacag ctataaaaat ttcgcccgca gcatggcgaa tttccaccca       660
     atgctggttc tcaatatgct ggaggacccc gaggacggga aaaaggcggc aagaatccgt       720
     cgttcctgta aacaatacct tgatgtagat atggagcatc tgggggtgct ttactttgac       780
     catcttcagg agattgcttt aggaagtcga attcctattg tcgcatataa accccagtcg       840
     gttttgagcc aggggattta tcggattgcc gataaattga tccagaaaca ggacgaggga       900
     gaaagtcctc ttgatctgat gagtcttgaa gagagttatc aggttgccga gatggaggct       960
     gagatcgatt ttgaagcaaa ggtccaggat atggagaacc ttctccactc cggtgccctt      1020
     acccggggag atctgattga tacgattcgg tctcaacaat atgagatatc aacattgaaa      1080
     aaagagaatc agctgttaaa atcaaaatta ctgaaagcag cggaaaacgg ttttcagata      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page