(data stored in ACNUC7421 zone)

EMBL: CP002116.PE153

CP002116.PE153       Location/Qualifiers
FT   CDS_pept        157889..160840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0156"
FT                   /product="protein of unknown function DUF342"
FT                   /note="COGs: COG1315 polymerase most protein contain PALM
FT                   domain HD hydrolase domain and Zn-ribbon domain; InterPro
FT                   IPR005646; KEGG: tde:TDE1398 hypothetical protein; PFAM:
FT                   protein of unknown function DUF342; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF342)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79313"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G9"
FT                   /protein_id="ADK79313.1"
FT                   /translation="MEQGKGSLKIEINEGGLNATLVLTADPEGEVWSLPKVQNVLEEKG
FT                   IIEGVSKAAVQEALQAFAEAEAGISVRKEIARGTEPEPATSEYYEWKELPLPESLKTQA
FT                   DRLFLEYAFPDIKIKRTEKVKVRKKVLKKSKLLFVAPKEQIVEEWQKKIVEEPAPINPK
FT                   VAATGYVEQGEYIAELRAGEPGKDGRSVLGKPLSPDPAKPILFYPGKGVKVDRNGLVAE
FT                   KSGFFRRGSNWVEVFDFLSHSWELSLSKDKATLLFAFTPGHREASIPEPSLIISKAGEE
FT                   FGFSVEQLKGPDKLREVMTRSVQTGKALERIPLTRDRDAFFSVEASSDNLKGLLTVVKG
FT                   SGRGKPLILRDVGAAIKASGFSGLDFGKIQNDLLEFYHGNGIELRDYLLAEGAAPSRGE
FT                   DRSFDFSVDFLPETEYEALKVGESGFPSEEAYPMSQARSLARVAEGTVVGVLSSAQEGS
FT                   PGKDVYGKVIPGIPGIDPHIELLENVRMEKERFIAETAGLLEVFDGADGIILRVRPYRD
FT                   AEVKIELSTDKMEAWLTIEPPAGSGTKANRSEIDQALKEVGIVKGIIEEAITDALEISG
FT                   AGSPVRRSVVARGKRPDDAGGSRIALIADRASGKGVTITRSGRADYRNQDRFVSVKAGA
FT                   LLAEILPNDQPAEDGWDLTGKPISAKDAPALDIDIGENIRQEEEGNRIKLYAACSGEFV
FT                   YEKKKLDILKVHTVSGDVDFSSGNVKFSGTVAVSGSVRSGFSILAEGHVKVAGNAESSL
FT                   ISSGESITIAQGIVGGGKAVIRAKSSIETIFAEQATLLAVGSVSMKNACLRCMVKCNGR
FT                   LRLVGEKGNLIGGVVRAREGVIAANIGNPKGSRTEISFGQDYLVMDRIELEEREVKKLR
FT                   NALARIDTTMASLEKQGDKGRLEMARKEKLKMMKMLEKRSMLLFTLRERFEQHFDSSVV
FT                   VRGTVYPGVVIESHGRYWSTETPKKGITLIFDQETGRIIEVSEAEPKEGEKSA"
     atggagcagg gaaagggttc gctgaagatt gagattaatg aaggtggttt gaatgcaacg        60
     cttgttctga cggccgaccc tgaaggggag gtctggagcc tccccaaagt ccagaatgtt       120
     ctcgaagaaa agggcatcat cgaaggggtt tccaaggcgg ccgtgcagga ggctttgcag       180
     gctttcgccg aggccgaagc gggcatctct gtgcgtaaag agattgcccg gggaaccgaa       240
     ccggaacctg ccacgagtga atattacgag tggaaagagc ttccccttcc cgagtctctg       300
     aaaacgcagg ctgatcgtct gttcctggaa tatgcttttc ccgatatcaa gataaaacga       360
     accgagaagg tcaaggtccg aaagaaggtc ctgaaaaaat caaagcttct ttttgtcgct       420
     ccgaaggaac agatcgttga agaatggcaa aaaaaaatcg ttgaagaacc agccccgata       480
     aatccgaagg tagcggctac aggctatgtg gaacaaggcg agtatatagc ggaactgagg       540
     gcgggagagc cgggtaagga tggtagaagt gttttgggta agccactttc ccccgatcct       600
     gccaagccga ttctttttta tcccgggaaa ggggtaaagg tcgataggaa cggactcgtt       660
     gccgaaaaaa gtggtttttt tcgtcgtggg agcaactggg tcgaggtatt tgatttcctt       720
     tcccatagct gggagctttc gctctcaaag gacaaggcaa cactcctttt tgcctttact       780
     cctgggcatc gggaggcttc cattcccgag ccttctctga ttatttccaa ggccggcgaa       840
     gagttcgggt tttccgtcga acagttgaag ggccccgata agcttcgaga ggtgatgacc       900
     aggagcgtgc aaaccgggaa agcgctcgaa cgcatccctt tgacgcgaga ccgggatgca       960
     ttcttttccg ttgaagcctc atcggataat ctgaaagggc tgcttaccgt cgtaaaggga      1020
     agtggtcggg ggaaaccgct gatcttgagg gacgtcggtg ccgccatcaa ggccagcggc      1080
     ttttccggac ttgattttgg aaaaatacag aacgacctac ttgagtttta tcacggcaac      1140
     ggtatcgagt tgcgtgatta ccttctggcg gaaggtgctg cccctagtcg gggcgaggat      1200
     cgttccttcg atttttcggt tgattttctt cccgagaccg aatatgaggc cctaaaggtg      1260
     ggggagagcg gcttcccctc ggaagaggca tatccgatga gtcaggctcg atcccttgcc      1320
     agggttgcag aagggacggt tgtcggtgtg ctctcgtctg cgcaggaagg aagccctgga      1380
     aaagatgtgt acggtaaggt cattcccgga attcccggaa tcgaccctca tatcgaactc      1440
     ctggaaaacg tccggatgga aaaagagcgt tttatcgccg agacggcagg gcttcttgag      1500
     gtttttgacg gcgccgacgg tattatcctc agggtgagac cctatcggga tgcagaggta      1560
     aagatcgagc tttcgaccga taagatggaa gcgtggctca ccatagaacc cccggcgggt      1620
     agcggcacaa aggcaaacag aagcgagatc gatcaggctc tgaaagaggt cggtatcgta      1680
     aaaggaatta ttgaagaagc aataaccgat gcccttgaga tcagtggagc gggaagtcct      1740
     gtccgaagaa gcgttgttgc caggggcaag cgtccggatg atgcaggggg aagcaggatt      1800
     gctcttattg ccgatagggc ctcgggcaaa ggggtaacga ttacccgatc cggtagggcc      1860
     gattaccgaa atcaagaccg tttcgtatcg gttaaagcgg gggccctttt ggctgagatc      1920
     cttccgaacg atcagccggc agaggacgga tgggatctta ccgggaagcc tatttccgct      1980
     aaagatgccc cggcccttga tatcgacatc ggtgagaata tcaggcaaga agaagagggt      2040
     aatcgtataa aactttatgc ggcttgttcc ggtgagtttg tatacgagaa aaaaaagctg      2100
     gatattctca aggtccatac ggtctccggg gatgttgatt tttcttcggg caatgttaaa      2160
     ttctccggta ccgtggcggt aagcgggagt gtgcgaagcg gtttttcgat ccttgccgag      2220
     ggacatgtaa aggttgccgg taatgcggag tcatcgctta tatcatcggg agaaagtatt      2280
     accatagcgc agggaatcgt tggcggcggt aaggccgtca tacgggcaaa aagcagtatt      2340
     gagacaattt ttgcagagca ggctaccctt ctcgccgtgg ggtcggtttc catgaagaat      2400
     gcctgtcttc gatgtatggt gaagtgtaat ggacggcttc gtctggtggg ggaaaaaggc      2460
     aatcttatcg gcggtgtggt tcgtgccagg gagggggtta ttgccgccaa tatcggaaat      2520
     ccgaagggct cccgaacaga gatctctttt ggacaagatt atctggtcat ggatcgtatc      2580
     gaacttgaag agcgtgaggt gaaaaagctc cgcaacgccc ttgccagaat cgatactacc      2640
     atggccagct tagaaaaaca gggagacaag gggcgtcttg agatggcgag aaaagaaaaa      2700
     cttaagatga tgaagatgct cgaaaagcga agtatgttgc tctttaccct gcgtgagaga      2760
     ttcgaacagc atttcgattc ttcggttgtt gtccggggga ccgtctaccc cggagtcgtt      2820
     atagaaagtc acggccgtta ctggagcacc gaaacaccga aaaaggggat taccctaatc      2880
     ttcgatcagg aaaccggccg aattatcgag gtttccgaag cggagcccaa ggaaggggaa      2940
     aaatctgcat ga                                                          2952
//

If you have problems or comments...

PBIL Back to PBIL home page