(data stored in ACNUC7421 zone)

EMBL: CP002116.PE155

CP002116.PE155       Location/Qualifiers
FT   CDS_pept        161842..162195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0158"
FT                   /product="Hpt protein"
FT                   /note="InterPro IPR008207; KEGG: srm:SRM_02645 conserved
FT                   hypothetical protein containing Hpt domain; PFAM: Hpt
FT                   domain protein; SPTR: Probable sensor/response hybrid,
FT                   putative; PFAM: Hpt domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79315"
FT                   /db_xref="GOA:E1R8H1"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H1"
FT                   /protein_id="ADK79315.1"
FT                   /translation="MRCMETIIHFDAAESALRLDRETLLMLLDAFFSTREDYIKPIKGA
FT                   IESRDAEALRSEAHRLKGAANNLRVTKIGTLAQTLEKSSSDADPSLLLSTLEQIEVSFS
FT                   AGEKELSVLKSEV"
     atgaggtgta tggaaacaat catccacttc gatgccgccg agtcggcgct tcgcctggac        60
     cgggaaacgc tcctcatgct tttggacgct tttttttcga caagagagga ctatatcaaa       120
     ccgatcaaag gggcgataga atctcgggat gccgaagctt tgagaagtga agcgcaccgc       180
     ctcaaagggg ctgccaataa tctgcgggtc acaaagatcg ggaccctggc ccaaactctt       240
     gaaaaaagtt cttcggatgc cgatccctct ttacttctat ctacactcga acagatagag       300
     gtctcatttt ctgcaggaga aaaagagctg tcggtcctca agtctgaggt gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page