(data stored in ACNUC7421 zone)

EMBL: CP002116.PE156

CP002116.PE156       Location/Qualifiers
FT   CDS_pept        162200..164248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0159"
FT                   /product="Alpha-galactosidase"
FT                   /note="COGs: COG3345 Alpha-galactosidase; KEGG:
FT                   shi:Shel_06470 alpha-galactosidase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Melibiase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79316"
FT                   /db_xref="GOA:E1R8H2"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H2"
FT                   /protein_id="ADK79316.1"
FT                   /translation="MNTSWSILFSYHLGSEEFELGGLSGGATFADGVRIVVEQRKLPLG
FT                   ERILFHAEPAPGGEGLFPVAERLELRLRCSSCEAVFLNGYQSWTESRELEAEVFPFRFR
FT                   RLFRPWINHYLLDRYGDACFTGRSFSKKRYHGCSFATLRKGKQVTLLAGMIEDRALSRI
FT                   EWRSERRGRGYLSFLPELSSNKISGVRTLMDLVVLTGEEEAVYEGWASAADGFGPVEPG
FT                   ESLSGWTSWYDHYEKVTEADVLRVLDSWQRLSLPPGVIQIDDGWQQAVGDWLRVKPTFP
FT                   RGMAPLAADISKAGMEPGLWVAPFIAEGSSLLFAEHRDWFLTDDAAEPLAAGNNPFNWS
FT                   GYFYALNIYHPEVKTYLRTLFSTIVKQWGFRFLKLDFLYAAALRLPEGKTRGEVMRDAV
FT                   AFLREISGEAKLLGCGVPLASAAGLVEYCRVGADVALRWEDRRLRALGYPERVSTLNAL
FT                   RSTISRRGLDGRFFLNDPDVFLLRDWNSDLNEQERFTLFLCNHIFGSLLFTSDDPGRYD
FT                   EATLALFRSGYPLRKKHGLRMNRIGECFEIEFSIGTLCYLAFINLENRPHHVTLASGLY
FT                   YAYGEGFRREGPLDLRPHQSICFLVVGETDFAVAGSTGMLFPGSEVERIDVDGEHVTLS
FT                   LAPGTLSEGLLFFRAPQGASGCSINGIDIEAEEKVGLRLCVVEKRLL"
     ttgaatacct cctggtcgat tcttttttcg tatcatctcg gctcggaaga attcgagtta        60
     ggtggcttaa gcggtggtgc cacctttgcc gacggagtcc gcatcgtcgt tgagcagaga       120
     aaacttccat tgggagagcg tattcttttc catgccgagc cggctcccgg gggggagggg       180
     cttttccctg tggccgaacg tttggagctt aggttacggt gttcctcctg tgaagcggtt       240
     tttctcaacg gctatcaaag ctggaccgag agcagggaac tggaggcaga ggttttcccg       300
     tttcgatttc ggcgcttgtt tcgtccctgg atcaatcact accttctcga ccgctatggt       360
     gatgcatgct ttaccggtcg ttccttttca aaaaagcgat atcatggatg ttcttttgcc       420
     acgcttcgta aaggaaagca ggtgacattg ctcgccggga tgattgagga tagagccctc       480
     tctcgaatcg agtggagatc ggagcgccgt ggtcgtggat acttgagttt tctgcccgag       540
     ctctccagta ataaaatcag tggtgttcga accttgatgg atcttgttgt actgacagga       600
     gaggaagagg ccgtctatga aggttgggcc tcggcagccg acggtttcgg acccgtggag       660
     cctggtgaga gcctgagcgg ttggaccagc tggtacgacc actacgaaaa ggtgacggag       720
     gcggatgtac tgagagtgct tgattcatgg cagcggcttt cgcttcctcc cggagttatc       780
     caaatagatg atggatggca gcaggctgtc ggtgactggc tgcgtgtcaa gccgactttt       840
     ccccgcggaa tggcccccct cgccgccgat atttccaagg ccgggatgga acctgggctt       900
     tgggtggcgc cctttattgc agagggctct tccctgcttt ttgccgagca tcgcgactgg       960
     tttctcaccg atgacgctgc agaacctctt gccgcgggta ataatccttt caattggagt      1020
     ggctattttt atgccctgaa tatctatcac cctgaagtga agacgtatct tcgtacgctc      1080
     ttctcgacaa ttgtgaaaca gtggggcttt cgtttcctta agcttgattt tctttatgct      1140
     gcggctcttc gcctgcccga aggaaagacc agaggagagg tgatgcggga tgccgtggcg      1200
     ttccttcgtg agatctccgg tgaagccaag ctcttgggct gcggggttcc tcttgcttcc      1260
     gcagccgggc ttgttgaata ttgcagagtt ggggcagatg tggcactgcg ctgggaagac      1320
     cgtcggctac gggccctcgg ttatcctgag cgtgtttcca ccctcaatgc cttacgcagc      1380
     accatctccc gcaggggctt ggacggtcgg ttttttctta atgatcccga tgtttttctg      1440
     ctccgggact ggaattctga cctgaatgag caggaacgtt ttaccctttt cctttgcaat      1500
     catatatttg gctctttgct ttttaccagc gacgatcccg gccgctatga cgaggcgacg      1560
     cttgccctgt ttcggtcggg atatcctctt cgaaagaagc atggccttcg gatgaaccgg      1620
     ataggagagt gcttcgagat tgaattctct atcggtaccc tttgctatct tgcctttatt      1680
     aatcttgaga atcgacctca tcatgttacc ttggcttccg ggctgtacta tgcatatggc      1740
     gaagggtttc ggcgggaagg ccctcttgac ctgcgtcctc atcaatcgat ctgttttctc      1800
     gttgttggtg aaaccgattt tgccgttgct ggttctaccg gcatgctttt ccccggtagt      1860
     gaagtcgaaa ggatagatgt ggatggagag cacgtgacgc tttcccttgc tcccgggacc      1920
     ctatccgagg ggctgctctt ctttcgggcc cctcaggggg ccagtggttg cagtatcaat      1980
     ggtatcgaca tagaggcgga agagaaggtc ggccttcgtc tctgtgtagt tgaaaaacgt      2040
     ctcctatag                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page