(data stored in ACNUC7421 zone)

EMBL: CP002116.PE157

CP002116.PE157       Location/Qualifiers
FT   CDS_pept        164351..165319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0160"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32);
FT                   InterProIPR000943:IPR014284:IPR009042:IPR007627:IPR
FT                   007624:IPR007630; KEGG: tcu:Tcur_3197 RNA polymerase, sigma
FT                   70 subunit, RpoD subfamily; PFAM: sigma-70 region 4 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   1.2; sigma-70 region 3 domain protein; SPTR: RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   3; Sigma-70 region 2; Sigma-70 factor, region 1.2; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79317"
FT                   /db_xref="GOA:E1R8H3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H3"
FT                   /protein_id="ADK79317.1"
FT                   /translation="MKYGTYSDTVIDSDVDFNDSDPLSLYLKQISAYPLLTKEEELMIG
FT                   REIQERKQELLELEELLGKEEIERSAYLFRKRTIEAVLRKSRDRMITSNLRLVVSIAKK
FT                   YQHRGLSFLDLIDEGNIGLIEAVERFDYTKRCKFSTYGTWWIQQSVIKALADKGRTIRI
FT                   PIHVLNIIRKLFSVTKHLTQELGRDPSSAEIAAYMDLPVERVESILQYSGETASLDVTV
FT                   DDENITSLSDLVFSDDYIEPFESVFHVTLKDLLDTILGQLSEREQTIIKLRFGLADRTP
FT                   LTLEEIGSILGITRERVRQIQNKAIEKLRSIAAIQELEEIV"
     atgaaatacg gtacatacag cgacacagtt atcgattctg atgtggattt caacgacagc        60
     gatcctctct ccctctattt gaaacaaatt tctgcttatc ctctgttgac aaaagaagag       120
     gaactgatga tcggaaggga aatccaagag agaaaacaag agttgcttga gcttgaggag       180
     ctcttaggca aggaagaaat cgagcggagt gcctatcttt ttagaaaacg aacgatcgaa       240
     gccgtacttc ggaaaagtag ggatcgaatg attaccagca acctgcggct ggttgtatcc       300
     atcgctaaaa aataccaaca tcgtggcttg agctttctcg atttgatcga tgaaggaaat       360
     atcggattga ttgaggcggt ggaacgtttc gattacacca agcgctgcaa attttccaca       420
     tatggaacct ggtggattca gcaatccgtt atcaaggcgc ttgcggataa ggggcgtacc       480
     attcgtattc ccatccatgt tctcaatatc attcgcaagc ttttttcggt taccaagcat       540
     cttacccagg agctcggccg cgatccctcc tctgcagaga ttgccgccta tatggacctt       600
     cctgtggaaa gggtcgaaag tatccttcag tattccggag agacggcgag tcttgatgta       660
     accgtcgatg atgagaatat tacaagcctt tccgatcttg ttttcagtga tgattacatc       720
     gaacctttcg agtccgtttt tcatgtgacc ctgaaggatt tgcttgatac tatcctgggc       780
     cagctctccg agcgtgagca gaccatcatt aaactgcgtt tcggacttgc cgatcggact       840
     cctcttacac ttgaggaaat tggctctatt ctcggtatta cccgggaaag ggttcgacaa       900
     atccaaaata aggcgatcga gaaattgcgc agtatcgctg ctatacagga gcttgaagag       960
     atcgtatag                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page