(data stored in ACNUC7421 zone)

EMBL: CP002116.PE158

CP002116.PE158       Location/Qualifiers
FT   CDS_pept        165410..165775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0161"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: gsu:GSU1289 chemotaxis protein
FT                   CheY; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Chemotaxis protein CheY; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79318"
FT                   /db_xref="GOA:E1R8H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H4"
FT                   /protein_id="ADK79318.1"
FT                   /translation="MTKKVLVVDDSRAIRRSISFVLEQNGYEVLEASDGVVGLAKLEEG
FT                   TVELIITDVNMPNMDGITFIKKVRELDAFRFVPILVLTTESQKSVMEDGKAAGATGWIV
FT                   KPFSTDKLMAAVRRVAG"
     atgacgaaga aggtactagt tgttgacgac tctcgggcca tccgccgaag tataagcttc        60
     gtgcttgagc agaacgggta tgaggtgctt gaggcgagtg atggagtggt gggacttgcg       120
     aagcttgaag aaggtacggt tgagcttatc attaccgatg tgaatatgcc gaacatggat       180
     ggtatcacct ttattaaaaa ggttcgggag ttagatgctt ttcgattcgt acccatcctg       240
     gtgctgacta cggaatctca gaaatccgtt atggaagacg gcaaagctgc gggggccacc       300
     ggttggattg ttaagccctt ttcaaccgat aaactgatgg ctgccgttcg gagggttgct       360
     ggctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page