(data stored in ACNUC7421 zone)

EMBL: CP002116.PE159

CP002116.PE159       Location/Qualifiers
FT   CDS_pept        complement(165785..166672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0162"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="COGs: COG2215 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR011541; KEGG:
FT                   dap:Dacet_2269 high-affinity nickel-transporter; PFAM:
FT                   high-affinity nickel-transporter; SPTR: High-affinity
FT                   nickel-transporter; PFAM: High-affinity nickel-transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79319"
FT                   /db_xref="GOA:E1R8H5"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H5"
FT                   /protein_id="ADK79319.1"
FT                   /translation="MNTRHRYVLFPFIFIIIFVTNSWGQQVNPFTATQKAPTESKQSSQ
FT                   PQKAVESGTLQTLSSMQKQLNAALSDTMKQLKDHPSAPVMALTMLIAFGYGFIHALGPG
FT                   HRKTILAALFASGRYRKRDALGAGMGFAFLHASSAVAIVGFLYFLSSGPISAGMDKIGL
FT                   ALEKGSFLLLVGIGLWIMISAIRALMAKEDKPAKKGVTVITIIGSGLIPCPGAALILSF
FT                   ALVYDIVPYGIVAVFCMSVGMGTALSIIAVAAKSIGASLIKLGERSKRTDRIHSALEFA
FT                   GGVVITTFALFMLT"
     atgaataccc gacatcggta tgttctattc ccttttattt ttattattat tttcgtcaca        60
     aatagctggg gacaacaagt aaaccccttt actgcgacgc aaaaggctcc tacagaatcg       120
     aagcaaagct cgcaaccaca aaaggcggtg gagagcggaa cactgcaaac cctgtcgtcg       180
     atgcagaaac agttaaatgc cgcattgtcc gataccatga agcagctgaa agatcaccca       240
     tcggcccctg ttatggccct taccatgctt atagccttcg gctatggctt tattcacgcc       300
     ttgggtccag ggcacagaaa gaccattctg gcggctcttt ttgcttcggg acgctataga       360
     aaacgagatg ccctgggggc gggaatgggc tttgcctttc ttcacgcaag cagcgccgtc       420
     gccatcgtcg gatttcttta tttcctttcc tccgggccaa tttcggcggg aatggacaag       480
     ataggacttg cccttgaaaa aggaagtttt ttgttgctgg ttggtatcgg tctctggata       540
     atgatatcgg caataagagc attaatggca aaagaggaca aaccagcaaa aaagggtgtg       600
     acggtaatta ccatcatagg ctcgggcctc attccctgtc ccggagcggc attaattctt       660
     tctttcgccc ttgtatatga catcgttccc tacggtattg ttgcggtatt ttgtatgtcg       720
     gtcggcatgg gaacggcatt aagtatcatt gcagttgcag caaagagcat aggggcatct       780
     ttgatcaaac taggtgaaag gtcaaagagg accgatcgaa ttcactcggc cctcgagttc       840
     gcaggaggag tggtaataac aacctttgca ctgttcatgc tgacatga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page