(data stored in ACNUC7421 zone)

EMBL: CP002116.PE16

CP002116.PE16        Location/Qualifiers
FT   CDS_pept        13031..14173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0016"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: lsp:Bsph_4187
FT                   NAD-dependent methanol dehydrogenase; PFAM: iron-containing
FT                   alcohol dehydrogenase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79176"
FT                   /db_xref="GOA:E1R6P4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P4"
FT                   /protein_id="ADK79176.1"
FT                   /translation="MKKAILNLPTALYCGRGCRSGLAECIPQEAKVALVTDKGLVGAPP
FT                   LDLVTTIFDEADISWKLISDIDPNPDEETVLRVVKAVKAMQADVIVAIGGGSPLDTAKA
FT                   AACMARNDGPLSDYQWEGKPFVNAPLPLYALPTTAGTGSEVTGVAVITSRNMKKGINAR
FT                   EIFPKAAFVDPELMIGLPPYLTAITGMDALTHAIEAYVGLGANPFSDALCEKAIELIAD
FT                   HLPRAFSYGGDIEAREAMGTASSLAGLAMDQAGLGIVHSLSSPVCAYLHVSHGLANAML
FT                   LPHGMRYNLPARHEKFAVVAELMGYDTTGMTPRDAAEAAVVAVEDLLEELELGSAIEEV
FT                   VHNAVDFEEFGNNASKMFLIRNNPRGADSKACRSIFETIF"
     atgaaaaaag cgattctgaa tcttcccacc gccctctact gtgggcgggg ttgtcgctct        60
     ggccttgcgg agtgtatccc tcaggaggcg aaggttgcgc tggtaacgga taaggggctg       120
     gtcggcgcgc cccctctgga tttggtgaca acgattttcg atgaggcaga tatttcctgg       180
     aagctaattt ccgatatcga tcccaacccc gatgaggaaa cagtacttag ggtagtcaaa       240
     gcggttaaag caatgcaggc cgacgttatt gtcgccatag gcgggggaag ccccctcgat       300
     actgcgaagg ccgctgcttg catggcacgg aacgatggac cgctttcaga ctaccagtgg       360
     gagggaaaac cctttgtcaa tgcccccctt ccgctctatg cgctgccgac aaccgcaggt       420
     actggtagtg aggtgacggg agtggccgtc atcaccagca gaaacatgaa aaagggcatt       480
     aatgccaggg agatttttcc caaagccgct tttgtagacc ctgagttgat gataggcctt       540
     ccaccctatc ttaccgcgat caccggaatg gatgccctga cccacgccat agaagcctat       600
     gtcggcttag gggccaaccc attttccgat gcgctttgtg aaaaggccat cgaattgatt       660
     gcggatcatc ttccccgagc cttttcttat ggcggggata ttgaggcgcg ggaggcgatg       720
     ggtactgcca gttctcttgc cggccttgct atggaccagg cagggctcgg catcgttcat       780
     agcctttcaa gtcctgtttg tgcctatctc catgtttctc atggcttggc aaatgccatg       840
     ctgctaccac atggaatgcg atacaatctg ccggcccgac atgagaaatt tgccgttgtt       900
     gccgaattga tggggtatga taccaccggc atgactcccc gggatgcggc tgaggcggct       960
     gttgttgctg tggaagattt gctggaagaa ttggagctcg gctccgcaat tgaggaggtc      1020
     gtacacaatg cggtcgactt cgaggagttc gggaacaatg cctccaagat gtttctcatc      1080
     cggaacaatc cccgaggtgc cgattccaag gcctgtcgct cgatcttcga aacaattttc      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page