(data stored in ACNUC7421 zone)

EMBL: CP002116.PE160

CP002116.PE160       Location/Qualifiers
FT   CDS_pept        complement(166684..167337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0163"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="COGs: COG3683 ABC-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR010412; KEGG:
FT                   tde:TDE0115 hypothetical protein; PFAM: protein of unknown
FT                   function DUF1007; SPTR: Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1007)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79320"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H6"
FT                   /protein_id="ADK79320.1"
FT                   /translation="MKLEKRHLPLFLFVFTLFIPCTLFAHPHMFIDSKTTLEFDEAGMK
FT                   GFWVEWLFDQFFTAQILLDYDRNMDKNFSADEISAIEAGAFSNLANYHYFISVTTGEAQ
FT                   VDIKKVSDFRAFMKDDRLGYTFFVPMAIPINNEKKPVQFRISIFDDTFFCDIAWMEKDS
FT                   VIVRAPGVFSVDWKILRNKNAPIIYDPTGGTARRNGVDYSGTVYPEELYIEVSK"
     atgaaattag aaaagcggca tcttcccttg ttcctctttg tgttcacact tttcataccc        60
     tgtaccctat ttgcccatcc gcatatgttc atcgatagta aaaccaccct tgaattcgac       120
     gaggcaggta tgaagggatt ctgggtcgaa tggctttttg atcaattttt tacggctcaa       180
     attcttctcg attacgatcg taatatggat aagaattttt ccgcagatga aatttcagcc       240
     attgaggccg gagccttcag caatctggcc aactaccatt actttatcag cgtcactacc       300
     ggagaagccc aagtcgatat taaaaaggtt tccgatttcc gcgcctttat gaaggatgat       360
     cgccttggct ataccttttt tgtccctatg gctattccca taaacaatga aaagaagcct       420
     gtacagtttc gtatttccat cttcgacgat accttttttt gtgatattgc atggatggaa       480
     aaggactctg ttatcgtccg tgctcccggt gttttttccg ttgattggaa aattctgcgg       540
     aacaaaaacg caccaatcat ctacgacccg accgggggta cggcaagaag aaacggggtc       600
     gattattcag gaaccgttta tcccgaagag ctatatattg aggtatcgaa atag             654
//

If you have problems or comments...

PBIL Back to PBIL home page