(data stored in ACNUC7421 zone)

EMBL: CP002116.PE161

CP002116.PE161       Location/Qualifiers
FT   CDS_pept        complement(167360..169501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0164"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR005225:IPR003373:IPR002917:IPR011619:IPR
FT                   011642:IPR011640; KEGG: pgi:PG1294 ferrous iron transport
FT                   protein B; PFAM: Ferrous iron transport protein B domain
FT                   protein; GTP-binding protein HSR1-related; nucleoside
FT                   recognition domain protein; Ferrous iron transport B domain
FT                   protein; SPTR: Ferrous iron transport protein B; TIGRFAM:
FT                   ferrous iron transport protein B; small GTP-binding
FT                   protein; PFAM: Ferrous iron transport protein B; Ferrous
FT                   iron transport protein B C terminus; Nucleoside
FT                   recognition; TIGRFAM: ferrous iron transporter FeoB; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79321"
FT                   /db_xref="GOA:E1R8H7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H7"
FT                   /protein_id="ADK79321.1"
FT                   /translation="MGSFRFALTGNPNSGKTSIFNAATGANQKVGNWGGVTVDVKEGNI
FT                   RRGNDRVTLIDIPGTYSLSAYTMEELVAREVIIKGDADVIINVLDSTNLERNLYLGVQV
FT                   MEMGRPMVLAFNMSDELKRSGTVIDTEALSRLFGIPIRFTVGRNGEGVRELLDEAIRVA
FT                   KGEHPATRQVSVNYGKEIEAAIESLAELVEKSSFNLRGISPRWYALKLLERDDEILRKV
FT                   RERVPADSPDDNVIFKELESRSKEIEQLYGEDAATIISERRYGFIIGALNETVNKPKAN
FT                   RINISEKIDDVLTNRFLAYPIFAFFMWILFQTTFGLGAYPMAWIESGITALGNWIGTTM
FT                   PPGAIRDLLTDGVIAGVGGVLVFLPNILILFLGISILEDTGYMARIAFIMDKVMHRIGL
FT                   HGKSFIPLVMGVGCSVPAIMAARTLESKKDRILTILIAPLITCSARLPVYILFTGAFFP
FT                   NIAGNVIFILYFLSFLFAFGMGWLFRKTLFRGEEYPFVMELPPYRIPTFRSALIHMWEK
FT                   AKHYLQKMGGVVLIFSIIIWFLGNYPKQPEMEKQYDTMIAEQREQGHQEEVQALQRELK
FT                   RKQVMQSYIGKAGTFIEPVLAPLGFDWRMDVSLMTGFVAKEVVVSTLGVLFTAGNEEGK
FT                   EESGTELRDALRDAYSPLVGFAFLIFVMLYTPCIVAFVTLVKEVGSWKWSIFSLGYQLT
FT                   LAWIAAFIVYRGGIILGLG"
     atgggctcat tccgttttgc tctgaccgga aatcccaact cgggaaaaac ctcaatcttt        60
     aatgccgcaa caggcgctaa tcaaaaggtt gggaactggg gaggggtcac cgtcgacgtc       120
     aaagagggga atatacgacg gggaaacgat cgcgttacct tgatcgatat cccggggacc       180
     tacagcctat ctgcctacac catggaggaa ctggtcgcca gagaagtcat tatcaagggc       240
     gatgcagatg tcatcatcaa cgttctcgat tcaaccaacc tggaacgaaa cctctacctc       300
     ggagttcagg ttatggaaat gggtcgtccc atggtgttgg cctttaacat gagtgatgag       360
     ttaaagcgat cgggaacggt tatcgatacc gaagccctca gcaggctctt cggaattccc       420
     attcgcttta ccgtaggccg caatggagaa ggggtccgtg agctccttga cgaagcaatc       480
     cgggtcgcaa agggagaaca cccggcgact cgccaggttt ccgttaacta cggcaaggag       540
     atcgaggcgg ctatcgaaag ccttgccgaa cttgtggaaa aaagttcctt taatcttcgg       600
     ggaataagcc cgcgttggta tgcattgaaa ctactggaac gggacgatga aattctccgc       660
     aaggtgcggg aacgtgttcc cgcagattct cccgatgata atgtgatctt caaagagctg       720
     gaaagtcgga gcaaggaaat cgaacagctc tacggagaag atgcggcaac gatcattagt       780
     gaacgacgtt acggcttcat catcggagca ctgaacgaaa ccgtcaacaa gccgaaagca       840
     aataggatta atatcagtga aaagatcgat gatgttctca caaaccgctt tctggcatat       900
     cctatcttcg ccttttttat gtggatactg ttccagacga ccttcgggct gggagcctat       960
     cccatggcct ggatcgaatc ggggataacc gcactaggca actggatcgg tacgaccatg      1020
     ccaccgggag cgattcgcga tctgctgacc gacggagtta ttgcaggggt cggcggcgtt      1080
     cttgtgtttc ttccgaatat tctcatcctc tttcttggaa tctccatcct tgaagacacc      1140
     ggatacatgg ccagaatcgc ctttatcatg gacaaggtca tgcacaggat cggacttcat      1200
     gggaaaagct tcattcctct ggtcatggga gtgggctgta gtgtaccggc catcatggca      1260
     gctagaactc tggagtccaa gaaagaccgt atcctaacca ttttaattgc ccccctgatt      1320
     acctgcagcg cccgacttcc ggtttacatc ctgtttaccg gcgccttttt tcccaatatc      1380
     gccggcaatg tgatttttat actctacttt ttgagtttcc tttttgcctt tggtatggga      1440
     tggctttttc gaaagacact cttccgtggc gaagagtatc cctttgtgat ggaactcccc      1500
     ccttatcgaa ttccaacctt tcgcagtgca ttgatccata tgtgggaaaa ggcaaagcac      1560
     tatctccaga aaatgggagg cgttgtgctg atcttctcca tcatcatttg gttcctcgga      1620
     aattacccga aacagcccga aatggaaaag cagtacgata cgatgatcgc cgagcaacgg      1680
     gaacaggggc atcaggagga ggtccaggct ctacagcgag agcttaagcg taagcaggtg      1740
     atgcagagtt acataggaaa ggcagggacc tttatcgagc cggtgcttgc gccccttggc      1800
     tttgattggc gcatggatgt cagtctcatg actggttttg tagcaaaaga ggtcgtcgtt      1860
     tcaaccctcg gcgtcctttt taccgctgga aacgaagagg gaaaagagga gtcgggaacc      1920
     gagctcaggg atgcactcag agacgcttat tcaccgttgg tcggcttcgc ctttttgatt      1980
     ttcgtcatgc tttatacgcc ctgtatcgta gctttcgtca cccttgtgaa agaggtcggc      2040
     tcgtggaaat ggtcgatctt ttctcttgga tatcagctta ccctcgcctg gattgccgct      2100
     tttattgtgt atcggggcgg tatcatcctt ggcctgggat aa                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page