(data stored in ACNUC7421 zone)

EMBL: CP002116.PE162

CP002116.PE162       Location/Qualifiers
FT   CDS_pept        complement(169501..169779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0165"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: dat:HRM2_10920 Fur; PFAM: FeoA
FT                   family protein; SPTR: Fur; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79322"
FT                   /db_xref="GOA:E1R8H8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H8"
FT                   /protein_id="ADK79322.1"
FT                   /translation="MKKTLSQYRQGDIVTITRLNGSGRLKNRLMELGFRRGETISIIRY
FT                   APLKDPVEILVAGCNVSLRVEEADMIEVEPAKDQYIHAAEGECAGSL"
     atgaagaaaa cgctcagtca atatcgccag ggagatatcg tcaccataac aagattaaac        60
     ggaagcggaa ggctcaaaaa tagactcatg gaattgggtt ttcgccgagg tgaaacgata       120
     tcaattatca gatacgcccc cctaaaagat ccggttgaaa ttttggttgc agggtgcaat       180
     gtttcgctgc gagtcgaaga agcagatatg atagaagttg agccggcgaa ggatcagtac       240
     atacatgcag ccgaaggcga atgtgcgggg agcctttga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page