(data stored in ACNUC7421 zone)

EMBL: CP002116.PE163

CP002116.PE163       Location/Qualifiers
FT   CDS_pept        170022..172286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0166"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); InterPro
FT                   IPR006276:IPR013215:IPR002629; KEGG: drm:Dred_1751
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein;
FT                   PRIAM:5-methyltetrahydropteroyltriglutamate--homocy
FT                   steineS-methyltransferase;
FT                   SPTR:5-methyltetrahydropteroyltriglutamate--homocys
FT                   teinemethyltransferase;
FT                   TIGRFAM:5-methyltetrahydropteroyltriglutamate/homoc
FT                   ysteineS-methyltransferase; PFAM: Cobalamin-independent
FT                   synthase, N-terminal domain; Cobalamin-independent
FT                   synthase, Catalytic domain; TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79323"
FT                   /db_xref="GOA:E1R8H9"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H9"
FT                   /protein_id="ADK79323.1"
FT                   /translation="MICKTLVTGFPRIGENRELKRALEHYWSKTASLQELRATAAELRK
FT                   RHWLFQKRQNIDFISSNDFSYYDNMLDTIVMLNAVPDRFSGIEDETERYFAMARGTAGA
FT                   SAMTMSKWFDTNYHYIVPELSGTLDFRLCPGKILTEYAEAKKLGVKTKINVIGPITFMG
FT                   LSRASKGENPFGYASRIIPLYKELLARCAELDDTLYIQMEEPYLVKNPTAEVLALLKAA
FT                   YQDLASVSSNIRIIVTSYFEHSNETTKILAETPIWGLGLDFVHGPQNIQGLKYAKGKKI
FT                   FAGVVDGRNIWRNDLGASLFLLEKISDMVGREQVVVSTSCSLLHVPYSLQNEPESDIKQ
FT                   HLAFCCEKVEELALLGRVFRGEVVLDSDNIGMKTARSRTPSTQHDGPADIAFGERKVRA
FT                   GDFAERNALQRRKFHLPKLPTTTIGSFPQTQELRRLRRDFKKRAISEEAYEQGIKTYID
FT                   DCIAFQEEIGLDVLVHGEPERNDMVEYFGEMLKGFHFTDNGWVQSYGSRCVKPPIIYGD
FT                   ISRTKPMTVRWISYAQRRSKKPVKGMLTGPVTILNWSFVREDIPRPLVARQIAAALCEE
FT                   VADLQAAGISIIQVDEAAFREGYPLRKENVSAYERWAVDSFRLAVSSAAKETQIHTHMC
FT                   YSDFTDIIKTIEAMDADVITIETARGGNRLLDVFEREGYHNEIGPGVYDIHSPRIPSED
FT                   EFEKQIFSRLEVLDGKRMWINPDCGLKTRRWEEVRPALQHMVSATRNVRLTLERNETSL
FT                   T"
     atgatttgca aaactctggt taccggtttt cctcggattg gggaaaacag agagctgaaa        60
     agggccctcg aacactattg gtcgaaaact gcttcgcttc aggagctccg cgcaacggct       120
     gccgagttac gaaaacggca ttggctgttc caaaaaagac aaaacatcga ctttatcagc       180
     tcaaatgatt tcagctatta cgacaatatg cttgacacca ttgtgatgct gaatgccgtt       240
     cccgaccgct tttccggtat cgaggatgag accgagcgtt attttgccat ggcaagaggg       300
     acggctggag cttcagccat gaccatgtcc aaatggtttg atacgaacta tcactatatc       360
     gttcctgagc tttccgggac gcttgatttt cgcctttgtc ccggaaaaat cttgactgag       420
     tatgccgaag ctaagaaact cggggtaaaa acaaaaataa atgtgatagg ccccattacc       480
     tttatgggcc tatcacgggc ttccaaaggt gaaaaccctt tcggctatgc gagtcgcatc       540
     ataccgctct acaaagaact tttggcaagg tgtgcggagc tggatgatac cctttatatt       600
     cagatggaag agccttatct tgtgaagaat ccgactgcgg aggttcttgc tctgcttaaa       660
     gcggcatatc aggacctggc ttccgtcagc tccaatattc ggattatcgt gacaagctac       720
     tttgagcact cgaacgagac aacgaaaatt cttgcagaaa ctcctatctg ggggctgggc       780
     cttgatttcg tccacggccc tcaaaatatt cagggattga aatacgcaaa gggtaaaaaa       840
     atttttgccg gtgttgtcga cggacgcaat atttggagga atgatcttgg tgcctctctt       900
     tttctccttg agaaaatctc agatatggtc ggtagggaac aggtcgttgt ttccacgagt       960
     tgttctcttc tccatgttcc ttattcgctt cagaatgagc ctgaaagtga tattaagcag      1020
     catcttgctt tctgctgtga gaaggtcgaa gagttggctt tgctcggtag agtctttcgg      1080
     ggtgaggtag tattggattc ggataacata ggtatgaaaa cggccaggag ccgaaccccc      1140
     agcacacaac acgatggtcc ggccgatatc gcgttcggag agcgaaaggt gcgtgccggt      1200
     gattttgccg agagaaacgc ccttcagcga aggaaattcc atttgccgaa acttccgacg      1260
     acgacaatcg gcagctttcc tcagactcag gaattaagaa ggttgagacg ggatttcaaa      1320
     aaacgtgcta tatcggaaga ggcgtatgaa cagggtataa agacctatat tgatgactgt      1380
     attgcatttc aagaggaaat tggccttgat gttctggttc atggggagcc cgagcgaaac      1440
     gatatggttg agtatttcgg cgaaatgctt aagggtttcc attttaccga caacggatgg      1500
     gtgcaaagct atgggagccg ctgtgtaaaa cctcctatca tatatggcga tatcagccgg      1560
     acgaaaccca tgaccgtacg ctggatcagt tatgcccaga ggcgaagtaa aaagccggtc      1620
     aaggggatgc tgaccgggcc tgtgacaatc ctcaactggt cttttgtccg ggaagatatc      1680
     ccccgccctc ttgtggcgcg gcagattgct gctgccttat gtgaggaagt ggcggatctc      1740
     caggctgccg ggatctcgat catccaggtc gacgaggctg cttttcgcga aggctacccc      1800
     ttgcgcaagg agaatgtttc cgcatatgag cggtgggcgg tcgatagttt ccgtttggct      1860
     gtttcttctg cggctaaaga gacccaaatc cacacacata tgtgctatag cgattttacc      1920
     gacattataa aaacgattga ggccatggat gccgatgtca taacgattga aacggccagg      1980
     ggcggcaatc ggctcctgga tgtgtttgaa cgggaaggct accacaatga aatcggtcca      2040
     ggcgtgtacg atatccactc cccccgcatc ccttcggaag atgaatttga gaagcagatt      2100
     ttttctcgtc tcgaggttct tgatggaaaa cgcatgtgga ttaatcccga ctgtggcctg      2160
     aaaacacgaa gatgggaaga ggttcgccct gctttgcagc acatggtatc cgctacccga      2220
     aacgtcaggc tcactctgga gagaaacgag acttctctaa cataa                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page