(data stored in ACNUC7421 zone)

EMBL: CP002116.PE164

CP002116.PE164       Location/Qualifiers
FT   CDS_pept        172378..172701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0167"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: iho:Igni_1229 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79324"
FT                   /db_xref="GOA:E1R8I0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I0"
FT                   /protein_id="ADK79324.1"
FT                   /translation="MHNTFAMKFGLDRGRRHMFHGHGHRNHHCQEMGSVVLSGVDAGSS
FT                   VRVVCLFGGQDAKRKLLDMGLVPGELLKVVQNDSDGPLLLQVQGSRLMIGRGLADKIRV
FT                   AAA"
     atgcacaata cctttgcaat gaaatttggg cttgatagag gccggcggca tatgtttcac        60
     ggacatggtc acagaaatca ccactgtcag gagatgggct ctgtggtatt aagtggtgtg       120
     gatgccggaa gctctgtgcg cgtggtatgt cttttcggag gccaggatgc caagcgcaaa       180
     ctcctcgata tgggtcttgt gcccggtgaa ctcctcaagg ttgttcaaaa tgatagcgac       240
     gggccgcttt tactgcaggt acaagggagt cgactcatga tagggagagg tcttgctgat       300
     aagattcgtg tcgctgcagc atag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page