(data stored in ACNUC7421 zone)

EMBL: CP002116.PE165

CP002116.PE165       Location/Qualifiers
FT   CDS_pept        172799..173035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0168"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: alv:Alvin_1526 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79325"
FT                   /db_xref="GOA:E1R8I1"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I1"
FT                   /protein_id="ADK79325.1"
FT                   /translation="MGQLKEFRAGDNGTVIGFAPGSAQWKSRLLAMGMTVGTAFQVERV
FT                   APLGDPVEIMVRGSRITLRKGEAEALLVERRVS"
     atggggcagc tcaaggaatt tcgagccggt gataacggaa ccgttattgg attcgctcca        60
     ggttctgcac aatggaagag tcggcttctt gcgatgggaa tgaccgtagg aacggcgttt       120
     caggtggagc gtgtagcacc actgggggat cccgtggaaa taatggttcg gggcagccgg       180
     atcacactta ggaagggcga agcagaagcg cttcttgttg aaaggagagt atcatga          237
//

If you have problems or comments...

PBIL Back to PBIL home page