(data stored in ACNUC7421 zone)

EMBL: CP002116.PE167

CP002116.PE167       Location/Qualifiers
FT   CDS_pept        175463..175849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0170"
FT                   /product="Domain of unknown function DUF2023"
FT                   /note="InterPro IPR018594; KEGG: bfs:BF2690 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF2023; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2023)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79327"
FT                   /db_xref="InterPro:IPR018594"
FT                   /db_xref="InterPro:IPR036780"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I3"
FT                   /protein_id="ADK79327.1"
FT                   /translation="MKVLAHHIYEYKKGLRSLVLHTLDASYEAEAVRRLERNNISYLIR
FT                   RVNKRKINIFFGNKACVHVVTSFGDKPLNAFTPEEDFILGIMLGYNRTEQCKRYLARKE
FT                   IFEIEAETARDLSFLPSGSLEKTG"
     atgaaggtac ttgctcacca tatctatgaa tacaaaaagg ggcttcgcag cctggtgctg        60
     cataccctgg atgcctcata tgaagctgag gccgttcgtc gtcttgagcg aaataatatc       120
     agctatttga tcagaagggt aaataagcgg aaaattaata tttttttcgg taacaaggcc       180
     tgcgttcatg ttgtaacaag tttcggtgat aaacctttga acgcttttac gccagaagaa       240
     gatttcattt tgggaattat gcttggctac aacaggaccg agcagtgtaa gcgctatctg       300
     gccagaaaag agattttcga aatagaggct gagaccgccc gtgacctatc atttctgcct       360
     tcaggatcat tggagaaaac cggctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page