(data stored in ACNUC7421 zone)

EMBL: CP002116.PE168

CP002116.PE168       Location/Qualifiers
FT   CDS_pept        complement(175886..176524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0171"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR006675:IPR003607:IPR006674; KEGG: tex:Teth514_1141 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: metal dependent phophohydrolase; PFAM: HD
FT                   domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79328"
FT                   /db_xref="GOA:E1R8I4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I4"
FT                   /protein_id="ADK79328.1"
FT                   /translation="MATAEDKITLHEMVEVIVTILNARDPYTYEHSWRVAALCEQIAKE
FT                   MNVPQKWIDTLHIAAHLHDIGKVGIPDFILNKPGKLLPYEYELIKAHSIIGYQIVHKIP
FT                   ILQEIALYIRHHHERWDGKGYPDGLAGKEIPLGSRIIAVADTFDAITTHRPYRSPRPLG
FT                   EAFTEIKAAAGSQLCPETCEVFIGMEKKITQLLGTVEQELKEAGRSLKK"
     atggcaacag cagaagataa aatcaccctc catgagatgg tggaagttat tgtaacgatt        60
     ttaaacgcac gggatcccta cacctacgaa cattcctgga gagttgcggc actatgcgag       120
     caaattgcaa aagagatgaa tgttccacaa aaatggatag acactttgca tattgcggca       180
     catcttcacg acataggtaa ggtgggcatt cccgatttta ttctaaacaa acctggtaag       240
     cttttgccgt atgaatacga gcttatcaag gctcattcga tcatagggta tcaaatcgtc       300
     cacaagattc ccattctgca ggagattgca ctctatatca ggcatcatca tgagcgatgg       360
     gacggtaagg gctatcccga tggtttggca gggaaggaga tacccctggg ctccagaatc       420
     attgcggtag cagatacctt cgacgctatc acaacccata gaccatatcg ctcccctcgg       480
     ccattaggag aagccttcac cgagataaaa gcagcggcag gaagccagct ttgccccgaa       540
     acctgcgagg tttttatcgg gatggagaaa aagataacac aacttctcgg tactgttgaa       600
     caagagctaa aggaagccgg tagatcatta aaaaaataa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page