(data stored in ACNUC7421 zone)

EMBL: CP002116.PE17

CP002116.PE17        Location/Qualifiers
FT   CDS_pept        complement(14170..14577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0017"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0229 Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase; InterPro
FT                   IPR002579; KEGG: bpt:Bpet1710 methionine sulfoxide
FT                   reductase B; PFAM: Methionine sulfoxide reductase B; PRIAM:
FT                   Peptide-methionine (R)-S-oxide reductase; SPTR: Peptide
FT                   methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-R-sulfoxide reductase; PFAM: SelR domain;
FT                   TIGRFAM: methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79177"
FT                   /db_xref="GOA:E1R6P5"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P5"
FT                   /protein_id="ADK79177.1"
FT                   /translation="MESSSKMPHGESEWRDKLGPERYYVCRMKGTEAPFSGKLWDEHRK
FT                   GTYHCVGCGTPLFRSETKYDSGSGWPSFMDLIDQKRVERRTDSSHGMIRTELLCARCGC
FT                   HLGHLFEDGPQPTGLRYCINSVSLKFIAATS"
     atggaatcgt ccagtaagat gccccacggt gaaagtgaat ggcgggacaa actcggcccg        60
     gaacgatatt atgtgtgcag gatgaaggga acggaggccc ctttttccgg gaaactatgg       120
     gatgaacaca ggaaaggaac ataccactgt gtcggctgcg gaacaccact ttttcgttcg       180
     gaaacaaaat atgactcggg aagcggatgg cccagtttca tggatctcat cgatcagaag       240
     agagtggaac gccgtaccga cagtagtcac ggcatgatcc gcaccgagct gctctgtgcc       300
     cggtgcgggt gccatctcgg ccatcttttt gaagatggcc cgcagcctac aggcttacgc       360
     tactgcatta attcggtatc cctgaaattc atcgccgcta cttcttag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page