(data stored in ACNUC7421 zone)

EMBL: CP002116.PE170

CP002116.PE170       Location/Qualifiers
FT   CDS_pept        complement(177237..178136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0173"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="COGs: COG4822 Cobalamin biosynthesis protein CbiK
FT                   Co2+ chelatase; InterPro IPR010388:IPR019758; KEGG:
FT                   ctc:CTC00743 anaerobic cobalt chelatase CbiK; PFAM:
FT                   anaerobic cobalt chelatase; PRIAM: Sirohydrochlorin
FT                   cobaltochelatase; SPTR: Anaerobic cobalt chelatase cbiK;
FT                   PFAM: Cobalt chelatase (CbiK)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79330"
FT                   /db_xref="GOA:E1R8I6"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I6"
FT                   /protein_id="ADK79330.1"
FT                   /translation="MKSKSMRKVACMALALAGSLMLAACASTGGEKLTMNTNGKKGILV
FT                   ISFGTSYPETRAVTIDACEQKIAEAFPEYEVRRAFTSHIIIGILDKRDGIHVDAPAEAL
FT                   EKMYKEGFSEVLIQPLHIIPGEEYTGEVLAVARRYSGKFEKIAIGSPILSTTENYWKAV
FT                   DAVSAQLPSLGTGEAVVLMGHGTEHPANCAYAAFQYMLARKGLPVYVGTVEGYPALDDV
FT                   IDLLHRDHISKVTLMPFMVVAGDHATNDMAGDEDDSWKSILTKEGFTVDVYLHGLGENS
FT                   IIQNMYIDNLHSAEVINE"
     atgaaaagca aaagcatgag gaaagtagcc tgcatggctc ttgccctcgc agggagtttg        60
     atgcttgctg cttgtgcaag cacgggagga gaaaagctga caatgaacac aaacggcaaa       120
     aagggaattc ttgtgataag tttcggtacg agctatcccg aaacacgggc agtgaccatt       180
     gatgcctgtg aacaaaagat tgccgaggcc ttccccgaat atgaggtacg gcgcgctttt       240
     accagccata ttatcattgg tattctggat aaacgggatg gtattcatgt cgacgcgccc       300
     gcagaggctt tggagaagat gtataaagaa ggcttttcgg aagtgcttat ccagcccctg       360
     cacatcattc ccggagagga atacacgggc gaggttctcg ccgtcgcacg tcgctattct       420
     ggaaaattcg aaaagatagc gataggctct ccgatccttt ccaccacgga gaattattgg       480
     aaagcagtcg atgccgtttc agcccagttg ccttccctcg gaacaggaga agccgtggtg       540
     ctgatgggac atgggaccga gcatccagca aactgcgcct acgcagcatt ccagtacatg       600
     ctcgcgcgaa agggtttacc cgtatatgtg ggaaccgtgg aagggtatcc tgcactcgac       660
     gatgttatcg atctgctgca tcgtgatcat atctcaaagg tgacattgat gcccttcatg       720
     gttgtagcag gagatcatgc aacaaacgat atggctgggg acgaggatga ttcctggaag       780
     agcattctta ccaaagaagg ctttacggtc gatgtctatc tccatggact tggagaaaac       840
     agcataatcc agaatatgta cattgataat ctgcatagcg ccgaagtcat aaacgaatag       900
//

If you have problems or comments...

PBIL Back to PBIL home page