(data stored in ACNUC7421 zone)

EMBL: CP002116.PE171

CP002116.PE171       Location/Qualifiers
FT   CDS_pept        complement(178164..180140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0174"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4771 Outer membrane receptor for
FT                   ferrienterochelin and colicins; InterPro
FT                   IPR012910:IPR000531; KEGG: cts:Ctha_2253 TonB-dependent
FT                   receptor; PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; SPTR: TonB-dependent receptor; PFAM:
FT                   TonB-dependent Receptor Plug Domain; TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79331"
FT                   /db_xref="GOA:E1R8I7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I7"
FT                   /protein_id="ADK79331.1"
FT                   /translation="MAMTRQLLPVVLLIAGAFAWPPALSAQQQEGKPEDEAAEAQAETI
FT                   EEQTEEADALPVLNIVVAGTRTEKEQKDSPIQTEVITEDQIEASGSDTLEGVLGETGLQ
FT                   FAETGMGSHVQMQGMDGERILFLIDGRRVSGRVASNIVANTIAMDNVERIEIIRGPQSA
FT                   LYGSEAIGGVINIITKEPDYELSGDYQVTTRALLPISESSDPAYTSLANKQSGLAHLNL
FT                   PIGAFANRLTLSAEHAFPYLDDEDQSLYPGATRADAGLDSDIVLSSGGTLAFGSAYSFH
FT                   RQKENISSGGAFDRIDTQRLNSYIAYDVTTEKKGFLKANLYHNYFQRDKSQYSSILDEW
FT                   NDSGSEYQHYLSGDLQYTQPLGDQNELTMIGSYGYDRLKKYNIGDYAVHQRHTFSLVLQ
FT                   DEQYKKDSYSLLAGLRSEYSNDYGIFFAPKLSGMYVPRPGIRILPSVGLGYRAPSFLEL
FT                   YLDSAGNIYHKYGNPDLDPERSVSFNLGVDWTRENVTLQFAGYHSELSDEIVYDYTDRA
FT                   DDDGRQVIIKENLDRSSRSGFDLSLNWNVLSDLSMTARYGYLFAYDRSAGEELDLVPSH
FT                   TGGASVHYLLKPLALKAKFSTSVTGPHERSEHTLVTFDVYLEKSLKDNFELFGGVDNIT
FT                   GVQDDFSDLLAGPVLYLGIRGSF"
     atggccatga caagacagct tttaccggtc gtattgctca ttgccggggc ctttgcatgg        60
     cccccggccc tttccgctca gcaacaggag ggaaagccag aagatgaagc agccgaagca       120
     caagcagaaa caatagaaga gcaaacagag gaagcagatg cactgcctgt gctgaatatc       180
     gtggtggcgg gaacgcggac cgaaaaagaa cagaaggatt cgccgattca gaccgaggtg       240
     atcacggagg atcagattga ggcttccggt tccgatactc ttgaaggagt tctgggagaa       300
     acgggccttc agtttgccga aacgggaatg ggaagccatg tccagatgca gggtatggac       360
     ggggaaagga ttctttttct catcgacggc cgaagggtaa gcggcagggt ggcatccaat       420
     atcgtggcga ataccattgc catggataat gttgaacgga ttgagatcat acgaggtccg       480
     cagtcggccc tgtacggttc cgaggcaatc ggcggagtga tcaacatcat caccaaggaa       540
     ccggactacg aactatcggg agattatcag gtcacgaccc gagccctgct accgatctcg       600
     gagagttccg atcccgctta cacatcattg gcaaacaaac aaagcggcct ggcccaccta       660
     aaccttccta tcggggcctt cgccaaccgc cttaccctgt cggcggaaca cgcctttccc       720
     tatctggacg atgaagacca gtccctctat ccgggcgcca ccagggcaga cgcaggactt       780
     gattccgata tcgttctttc atccggaggg accctggcct ttggtagtgc ctactccttt       840
     catcgccaga aggagaatat ctcctcggga ggggccttcg accgaatcga tacccagagg       900
     cttaattcct acatcgccta tgatgttacc acagagaaga aaggctttct caaagcaaac       960
     ctctaccata actacttcca gcgggataaa tcccaataca gcagcattct ggacgagtgg      1020
     aacgactccg gcagcgaata tcagcactat ctaagcgggg atctccagta cactcagccg      1080
     cttggagacc agaacgagct gacgatgatc ggttcctacg gttacgacag actcaaaaag      1140
     tacaatatcg gagactatgc ggttcaccag cgccatacct tttctctggt attgcaggat      1200
     gaacagtaca agaaggacag ctattccctg ctcgcaggct tgcggagcga gtacagcaac      1260
     gattacggca tcttcttcgc accaaaactc tccggcatgt atgtgcctag gcccgggata      1320
     agaatcctac cctctgtcgg gcttggttac cgtgcgccct catttctcga gctctatctc      1380
     gattccgcag gcaatatcta tcacaaatac ggcaatcccg acctggatcc ggaaagatcc      1440
     gtttccttca atctcggtgt ggattggacc agggaaaacg taacgctgca attcgccgga      1500
     tatcatagcg aattgagcga cgaaatcgtc tatgactaca cggaccgggc cgacgacgac      1560
     ggacggcagg tcatcatcaa ggaaaacctc gatcgttcat cgagaagcgg tttcgacctt      1620
     tccttgaact ggaacgtgct aagcgacctc tccatgaccg cacgttatgg gtatcttttt      1680
     gcctacgata gaagcgcagg tgaagagctc gaccttgtac caagccatac aggaggggca      1740
     tctgtgcact acctcctgaa gcctcttgcc ttgaaggcca agttctcgac ttcggtgaca      1800
     ggccctcacg aaagaagcga gcataccctc gttacctttg atgtgtatct cgaaaaaagc      1860
     cttaaagata attttgaact attcggaggc gtcgacaata ttacgggtgt acaagacgac      1920
     ttctcggacc ttcttgcagg gccggttctc tatctcggca tccgcggcag cttctaa         1977
//

If you have problems or comments...

PBIL Back to PBIL home page