(data stored in ACNUC7421 zone)

EMBL: CP002116.PE175

CP002116.PE175       Location/Qualifiers
FT   CDS_pept        complement(183738..184700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0178"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: det:DET0688 cobalamin
FT                   biosynthesis protein CobD; PFAM: cobalamin biosynthesis
FT                   protein CbiB; SPTR: Cobalamin biosynthesis protein CobD;
FT                   TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis protein
FT                   CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79335"
FT                   /db_xref="GOA:E1R8J1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J1"
FT                   /protein_id="ADK79335.1"
FT                   /translation="MNLCLPILAGALLYDLLWGDPPNRFHPVAWMGSLISRLWQHRPKQ
FT                   GKWLLFSYGALMTICGALLFSLPLLLLNRIPILPRLVLSIVFLKMSFSLTTLLRTGDKI
FT                   ARALEAGDLASARKLTAFHLVSRNTSELEESELCGAVVESLAENLTDSFTSPLLYYLLA
FT                   GLPGAFAFRYINTSDAMIGYRTGDFEFGGKWAARCDDLLNFIPARVTALLIILAGSIIP
FT                   IRSAPGEGNGAGRKRSLASLFAWQNATESPNAGWTMGAAAAILGLRLEKRGHYVINSTG
FT                   RLPKPADIRRCIRLVRRSALLFLLLLAGILACTGVILGS"
     atgaaccttt gcctgccgat tcttgcggga gccctgcttt acgacctgct ttggggcgat        60
     cctcccaacc gttttcatcc ggtagcctgg atgggaagcc tcatttcccg cctctggcag       120
     catcggccca aacaggggaa gtggcttctt ttttcctacg gcgcccttat gaccatctgt       180
     ggagccctgc tcttttccct tcccctgctt cttctaaaca ggattccgat cctgccgagg       240
     ttggttctgt cgatcgtttt tttgaaaatg agcttttctc tcaccaccct cctgcgaacg       300
     ggggacaaga tcgcacgggc gctggaagcc ggggaccttg catcggcgag aaagctgaca       360
     gcctttcacc ttgtcagtcg gaacacgagc gaactggagg agtcggagct ctgcggtgcg       420
     gtggtcgaat cccttgcgga gaaccttacc gacagcttta cctcacccct tttgtactat       480
     cttcttgcgg gccttcccgg tgcctttgcc ttccgctata tcaataccag cgatgccatg       540
     ataggctacc gcacgggaga cttcgagttc ggaggtaaat gggcggctcg ttgtgatgat       600
     cttctgaatt ttatcccggc cagagtgacg gccttgctca tcattttggc cggaagcatc       660
     ataccgatac gatcagcccc tggggagggt aatggtgccg ggaggaaaag atccctggcg       720
     tccctctttg catggcagaa tgctaccgaa agccccaacg caggctggac catgggcgcc       780
     gcagccgcta ttttaggctt acgcctggaa aaaagagggc actacgtcat aaacagtaca       840
     ggtcgccttc cgaaacccgc cgacattcgc cgttgcatta ggctggttcg aagatcggcc       900
     cttctttttc ttctactttt ggccggtatc cttgcctgta cgggggtgat ccttggttcc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page