(data stored in ACNUC7421 zone)

EMBL: CP002116.PE176

CP002116.PE176       Location/Qualifiers
FT   CDS_pept        complement(184697..186169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0179"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR004459:IPR002586:IPR011698:IPR017929; KEGG:
FT                   deg:DehalGT_0781 cobyric acid synthase CobQ; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; SPTR: Cobyric acid
FT                   synthase CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79336"
FT                   /db_xref="GOA:E1R8J2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J2"
FT                   /protein_id="ADK79336.1"
FT                   /translation="MIQGTSSNVGKSLLVAAFCRIFARKGLRVFPFKSQNMALNSFVTS
FT                   EGLEIGRAQALQATAAKRDAEVAMNPVLLKPEGNSSSQVVLMGKPWRRLSGGEYYKAKP
FT                   ALWETITEVLDRAGKENDLLIVEGAGSPAEINLKEHEIVNMRVARYLQAPVLLAADIDR
FT                   GGVFAFLYGTLALLEPEERELVKGFIINKFRGDVELLKPGLDMLRNLTGGVPTLGVVPY
FT                   LKEISLAQEDSVFLEEHRFFGSGSTEIAVMLLPHISNYDDFDALTMEPGLQLRFVEHPR
FT                   ELGNPAAIILPGTKTTMADLLWLRQSGLAEAICRKVEEGTSVIGICGGFQMLGRQIIDK
FT                   EGVEGSAGSLRGLGLLDVTTYFSREKKTIQETGTLCSDKGTLAPMKGYKVSGYEIHMGH
FT                   SALGESAGPFLATGSGGRDGAVSPDGRIIGTYFHGLFDEAAFRRGWLASLGWEPEGKPV
FT                   SLVQRREEELEALADAVEAAIDMKQLEAIIGL"
     atgatccagg gaacatcctc gaatgtcggt aaaagcctcc ttgtcgccgc cttttgccga        60
     atctttgcgc gaaaggggct tcgggtcttt ccctttaaaa gccagaacat ggccctcaac       120
     tctttcgtaa ccagcgaagg cctggagatc ggcagagccc aggccctcca ggctaccgcg       180
     gcaaaacggg atgccgaggt agccatgaac ccggtactgc tcaagccgga gggtaacagc       240
     agctcccaag tggtgctgat gggaaagccg tggcgacgcc taagcggagg tgagtattac       300
     aaggcgaagc ctgcgttgtg ggaaaccatc accgaggttc tggatagggc ggggaaagag       360
     aacgacctgc ttatcgtcga aggagcgggc agccccgccg agatcaatct gaaggaacac       420
     gaaatcgtca acatgcgggt ggcaagatat ctacaggccc cggttcttct ggccgccgac       480
     atcgacaggg gcggcgtttt cgcattcctt tacggcaccc ttgcccttct cgagccggag       540
     gaacgggaac tggtcaaagg ttttatcatc aataaattcc ggggcgatgt cgaactgctc       600
     aaaccggggc tcgatatgct tcggaacctg acaggaggcg tcccgaccct gggcgtagtt       660
     ccctacctga aggagatctc cctcgcccag gaagattcgg tgtttctcga agagcaccgc       720
     tttttcggct ccggaagtac cgagatagcg gtcatgcttc tgccccacat ctccaattac       780
     gatgatttcg acgccctgac catggagccg ggcctacagc ttcgttttgt ggaacatcca       840
     agagagctgg gtaaccctgc ggcaatcatc ctgccgggaa ccaaaaccac catggcagat       900
     ctgctctggc tcaggcagag cggccttgcc gaggctattt gccgcaaagt cgaagaggga       960
     acatcggtca ttggtatctg cgggggcttt cagatgctgg gaaggcagat catcgacaaa      1020
     gagggggtgg agggcagcgc cggaagcctc cggggccttg ggctgctgga tgtaaccacc      1080
     tacttcagtc gggaaaagaa gacgatccag gagacaggga ccctctgcag tgataaggga      1140
     acccttgctc cgatgaaagg gtacaaggtc agcggttatg aaatccacat gggtcatagc      1200
     gcgctgggag agtcggccgg tccttttctt gcaaccggct caggagggcg cgacggtgca      1260
     gtatcaccgg acggccgcat catcggaacc tactttcacg gtctcttcga cgaggccgct      1320
     ttcagacggg gctggctcgc atctctgggc tgggagcctg aaggcaagcc tgtaagcctt      1380
     gtccagagga gggaagaaga actggaggcc ctggccgatg cggtggaagc ggccattgat      1440
     atgaagcagc tggaggcaat catcggacta tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page