(data stored in ACNUC7421 zone)

EMBL: CP002116.PE177

CP002116.PE177       Location/Qualifiers
FT   CDS_pept        186599..187630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0180"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   aoe:Clos_0318 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79337"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J3"
FT                   /protein_id="ADK79337.1"
FT                   /translation="MVFVRRALAVFLLFVCMTSLLFAGGTQEPASDRKVAGSPQSGMSI
FT                   LGESDASVRFREVSGRIVEIPKFPKRTVIMHNSILDLWYMAGGTSLARLRGAINVPAEA
FT                   KDLPVLGSIASIDVEKIMKLEPDLLIFSGTSEYQRKISDFFASEGVASLGINYENYDDF
FT                   GLIFDLFTRLNGRRDLYEAYLIPTQEKVQSIIDRVPKGVHPKVCILFASTNYVKVETEE
FT                   TVTGDYCKRLGAVNIYRESAFEGAGRVDLSLEYILEQDPDLIFVTTMGDVEKCTARIEM
FT                   EVSSNPVWASLSAVKNGRFHYLDKSFSIYKPNRAYPEAFQRIAELLYPGTDFSLGSGEG
FT                   KAE"
     atggttttcg ttcgaagggc tctcgccgtt tttcttttgt ttgtgtgcat gacatctctg        60
     ctttttgccg gagggacgca ggagccggca tccgaccgaa aggtggccgg tagtccgcag       120
     tcggggatgt cgatcttggg cgagagcgat gcgtcggtac gctttcggga ggtttcgggc       180
     cggattgtcg aaattcccaa attccccaaa cgaaccgtca tcatgcacaa ttcgatactc       240
     gacctctggt atatggccgg aggaacaagc cttgcccgcc tgaggggagc aatcaatgtg       300
     cccgccgagg caaaagatct tcccgtgctt ggttccattg ccagtatcga tgtcgaaaaa       360
     atcatgaaac tggaaccgga cttgcttatc ttttcgggaa caagtgaata ccagcgaaaa       420
     atcagtgatt tttttgcctc tgaaggggtg gcgagccttg ggatcaatta tgaaaactat       480
     gatgattttg gtctcatctt cgatctcttt accaggctca acggccgacg ggatctctac       540
     gaagcgtatt tgattccgac gcaggaaaag gttcagtcca ttatcgatcg ggtaccgaag       600
     ggcgtgcatc caaaggtgtg tatcctcttt gcttccacca actacgtgaa ggtggaaacc       660
     gaggagaccg tgaccggaga ctactgcaag cgtcttggag cggtgaatat ctatcgtgaa       720
     tcggccttcg aaggagccgg tcgagtcgac ctcagtcttg aatacatcct cgaacaggat       780
     cctgatctca tattcgtcac caccatgggt gatgtggaaa agtgtacggc caggatagaa       840
     atggaggttt catccaatcc tgtatgggct tccctttcgg ctgtgaaaaa cggacggttt       900
     cattatctgg ataagtcctt ttccatctac aagccgaacc gcgcctatcc cgaggcattt       960
     cagaggattg ccgaactcct gtatcctgga acggatttca gtctcggttc cggggagggg      1020
     aaggctgagt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page