(data stored in ACNUC7421 zone)

EMBL: CP002116.PE178

CP002116.PE178       Location/Qualifiers
FT   CDS_pept        187627..188652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0181"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   aoe:Clos_0319 transport system permease protein; PFAM:
FT                   transport system permease protein; SPTR: Transport system
FT                   permease protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79338"
FT                   /db_xref="GOA:E1R8J4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J4"
FT                   /protein_id="ADK79338.1"
FT                   /translation="MSRFDIRSRTGYRLAILVLLLCLLFAALLLAIRFGSSGFTFRQIL
FT                   RALFIDTTSVDHRILMMVRMPRAIAAALVGFCLALSGTLLQGVMRNPLASPNVIGVSAG
FT                   AGLAAVCIYILFPGHYFLVTPVAFGGAFLAALLVYLLAWKGGASPLRLVLSGIAVSSFL
FT                   GAGSNALMIFFPDRVQHVIGFMVGNLSAVTWQQVRILWPYAFIGFLFSMLLADRLNILL
FT                   LGDETANSLGLNVEASRMFFMLIASLLAASAVSIVGLLGFVGLIVPHVARLVIGNNARY
FT                   LIPASALLGAVVVLLCDTLGRVILRPQELPVGIIMAMLGAPFFLYLLRQKGEKMGGGHG
FT                   H"
     gtgagccgtt tcgatatcag gagccgtacc ggttaccgtc ttgcaatctt agtacttctt        60
     ctctgtctgc tgtttgccgc cctccttttg gcgatccgct tcggttcttc cggttttacc       120
     ttccgccaga tccttcgggc gctttttatc gacactacgt cggtggatca tcgcatcctc       180
     atgatggtgc ggatgccgcg agccattgcc gccgccctgg tcggtttttg tcttgccctt       240
     tccggtacac tcctgcaggg ggtgatgcgc aatccccttg cctcaccgaa tgtgatcggg       300
     gtttccgccg gggccgggct tgcggcggtc tgcatctata tcctttttcc cggccactat       360
     ttccttgtga cgccggtggc attcggcggg gccttcctgg ctgctctttt ggtctacctg       420
     ctggcctgga agggaggagc atccccgttg cgtctcgtcc tttcgggaat cgccgtctcc       480
     tcctttctcg gcgccggaag taacgccttg atgatcttct ttcccgatcg ggttcagcac       540
     gtgatcggtt ttatggtggg aaatctctct gccgtcacct ggcagcaggt ccgaattctg       600
     tggccctacg ccttcatagg gtttcttttt tctatgctct tggcggatcg actcaatatt       660
     ctgcttctcg gcgacgagac ggccaacagc ttgggcctca atgtcgaggc ctcccgcatg       720
     tttttcatgc tgattgcctc cctcctcgcc gcatctgcgg tcagtattgt gggactcctg       780
     ggctttgtgg ggctgatcgt ccctcatgtg gcgcggcttg tgatcgggaa taacgcccgt       840
     tacctcattc ccgcttcagc ccttctcgga gccgttgttg ttcttctctg cgacaccctc       900
     gggcgggtca tccttcggcc tcaggagctg ccggtgggta tcatcatggc gatgttgggt       960
     gcaccctttt tcctttacct gctcaggcaa aagggggaga aaatgggagg cggccatggt      1020
     cattga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page