(data stored in ACNUC7421 zone)

EMBL: CP002116.PE179

CP002116.PE179       Location/Qualifiers
FT   CDS_pept        188642..189424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0182"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: aoe:Clos_0320 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79339"
FT                   /db_xref="GOA:E1R8J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J5"
FT                   /protein_id="ADK79339.1"
FT                   /translation="MVIEADKLCLGYGGKPIVKDLSLSVPAGSWASIIGPNGCGKSTLL
FT                   KALSRNLKPVSGSVRVMDRPLDSYGGRGLARTMAFLAQTPQIPDYFSVKELVGYGRYPH
FT                   TGWFGSFRPRDREVVEQALEATDMLDFSEREVASLSGGERQRAWIAMALAQEAELLLFD
FT                   EPTTHLDIAYQFQILELIDRLRREMGRTVVTVLHDLNQAARYSDQLFVMKDGRIFATGE
FT                   PSVVLTPPLLGDVFSIDVRLLQDEEHDCPFVVPLGGKQ"
     atggtcattg aggctgataa gctttgtctt gggtacggcg gcaaaccgat tgttaaagat        60
     ctctctcttt ccgtgcctgc cggctcctgg gcatcaatca tcggtcccaa cggctgcggg       120
     aaatcgacgc ttctgaaggc cctttcccgc aacctgaagc ctgtttccgg ttccgttagg       180
     gttatggacc ggcccttgga tagttacgga ggacggggcc ttgcccgaac catggctttt       240
     ctcgcccaaa ctcctcaaat ccccgattat ttttccgtga aggaactggt gggctatggc       300
     agatatcccc ataccggatg gttcggcagc tttcgtcccc gggatcggga ggtggtggaa       360
     caggctctgg aggcaacgga catgcttgac tttagcgagc gcgaggttgc aagcctttcc       420
     ggtggtgaac gccagcgggc ctggattgcc atggccctgg ctcaggaggc ggaactcctg       480
     cttttcgacg agccgacgac tcatctcgat attgcctacc agttccagat cctcgagttg       540
     atcgacaggt tgcgaaggga gatggggcgg acggtggtga cggtactcca tgatctcaac       600
     caggcggccc gttactccga ccagcttttt gtgatgaaag acggtaggat ttttgctacc       660
     ggggaaccct cggtggtcct tacccctccg ctccttgggg atgtcttttc catcgatgtg       720
     cggctcctgc aggacgagga acatgattgt ccctttgtcg ttcctctggg aggaaaacag       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page