(data stored in ACNUC7421 zone)

EMBL: CP002116.PE180

CP002116.PE180       Location/Qualifiers
FT   CDS_pept        189424..190920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0183"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG1797 Cobyrinic acid a c-diamide synthase;
FT                   InterPro IPR004484:IPR002586:IPR011698:IPR017929; KEGG:
FT                   adg:Adeg_0183 cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; SPTR: Cobyrinic acid
FT                   a,c-diamide synthase; TIGRFAM: cobyrinic acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain; CobB/CobQ-like glutamine amidotransferase domain;
FT                   TIGRFAM: cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79340"
FT                   /db_xref="GOA:E1R8J6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J6"
FT                   /protein_id="ADK79340.1"
FT                   /translation="MEHISSLALPRFVIAGASSGSGKSTLTLALIEALHRRGYRPLPWK
FT                   VGPDYIDPGHLSAAAGLACRNLDPVLMGEAGMVSSFIGHCNEACRKEPKSLAVIEGVMG
FT                   LFDGRGGLSSEGSTASVAKSLSAPVIVVIDAGAAAQTAGAVALGMQQFDPDCPVAGFIA
FT                   NRIGSDRHFSMVRRAVEGATGLPVLGWLPKSSMPSMPERHLGLVAAWEEEGRQRLSSLL
FT                   RILGDAAAEHIDLDALLAIAASASSLTPIRGESVDGIDISGSSGGKADRAVAGIGTDTP
FT                   SPCIAVAMDDAFHFYYQDNLDMLESLGARIVPFSPLSASRLPDGCDGVYIGGGYPELHA
FT                   ERLSANRTMIESIRAASFDNMPIYAECGGLMYLCRRLFVGGKGYPMVGLFDTEIEMGNK
FT                   LSALGYHKARTLRPSVIGPAGMELVGHIYRWSNMVKGPSETEWLFRLDKEGTIGFDGLS
FT                   VRRSTAAYLHLHFTGVPEPARHLVAACREYRQSRSKHDEQ"
     atggaacaca tttcttccct tgcccttccc cgtttcgtaa ttgcgggagc atcttccggc        60
     agcggaaaga gtacgctgac cctggccctg attgaggcac ttcaccggcg cggctatcga       120
     cctcttccct ggaaagtcgg gcccgactat atcgatcccg gtcacctctc tgcagccgca       180
     gggcttgcct gcagaaacct cgatccggtg ctgatgggcg aggcggggat ggtttcctct       240
     tttattggac actgcaatga ggcctgccga aaagagccga aaagccttgc ggttatagag       300
     ggggtcatgg gacttttcga cggcaggggc gggctttctt ccgaaggctc caccgcctcg       360
     gttgcaaaaa gcctctcggc tcccgtgatt gtggtcatcg atgcgggagc cgccgcccag       420
     accgccgggg cggttgccct gggcatgcag cagttcgatc ccgactgccc tgttgccggt       480
     tttatcgcca acagaatcgg atcggatcgt cacttttcca tggttcgtcg ggcagtggaa       540
     ggggccaccg gtcttcctgt tctgggctgg cttccgaaat cgtccatgcc gtccatgccc       600
     gaacgccacc tcggtctagt cgctgcctgg gaggaggagg gtcggcaacg gctttcctcg       660
     ctcctgcgca tcctcggcga tgctgctgcc gagcatatcg acctggatgc tctgcttgcc       720
     atcgccgctt ccgcttcttc tcttacaccg atccggggcg aaagcgtcga tggtatcgat       780
     atttcgggca gctctggtgg taaggcggat agggctgtag ccgggatcgg gaccgatact       840
     ccttctcctt gcattgccgt ggcaatggac gatgcctttc acttctacta ccaggacaac       900
     ctcgatatgc tggaatcctt gggggccaga atcgtccctt tttcgcctct ttcggcaagc       960
     cggcttcccg atggctgtga cggtgtctac atcggcggcg gttatcccga gcttcatgca      1020
     gagcgacttt cggcaaaccg cacgatgatc gaatcgattc gggccgcttc ttttgacaat      1080
     atgcccatct acgccgaatg cggagggctc atgtaccttt gtcggcggct gtttgtcggg      1140
     ggaaaagggt atcccatggt cggcctcttc gatacagaga tcgagatggg caacaagctg      1200
     tcggccctgg gctaccacaa ggccagaaca ctaaggccga gtgtgatcgg tcctgcggga      1260
     atggagttgg tgggacacat ttaccgttgg tcgaacatgg tgaaaggtcc atccgaaacc      1320
     gaatggcttt ttcggctcga caaggaagga acgataggct ttgacggcct ttcggtgcgc      1380
     aggagtacgg ccgcctatct ccatctccac tttaccggcg ttcccgaacc tgcgcgacac      1440
     cttgtggcgg cttgcaggga atatcggcaa tcaaggagta agcacgatga acagtag         1497
//

If you have problems or comments...

PBIL Back to PBIL home page