(data stored in ACNUC7421 zone)

EMBL: CP002116.PE181

CP002116.PE181       Location/Qualifiers
FT   CDS_pept        190910..191554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0184"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="COGs: COG2082 Precorrin isomerase; InterPro
FT                   IPR003722; KEGG: scl:sce0238 hypothetical protein; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH; SPTR: Precorrin-8X
FT                   methylmutase CbiC/CobH; PFAM: Precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79341"
FT                   /db_xref="GOA:E1R8J7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J7"
FT                   /protein_id="ADK79341.1"
FT                   /translation="MNSSRGKAITEESFRIIRSRLGDFSAGDDVTEIVIRIAHTTGDVE
FT                   FGKSCHVPELSVKRGIEAISSGCPIVTDVEMVRTGIRAALAEKLGCRVHCFLNDTKVID
FT                   GTRQSGETRSALGMRQAAEHSLLNGAVVAIGNAPTALFALLSMIESGRVKPALVVGIPV
FT                   GFVGALESKQALYDSGYPCITNLSERGGSPIAAAIVNGLLFLAEQRAEQRG"
     atgaacagta gcagaggaaa ggcgattacc gaagagagtt tccgcatcat cagaagcagg        60
     cttggggatt tttccgcagg cgatgatgtg acggaaatcg tgatccgtat tgcccatacc       120
     accggcgatg tggagtttgg aaagagctgt catgtgcctg agctttccgt gaagcgggga       180
     atagaagcga tatcttcggg ctgccccatt gtcaccgatg tggagatggt gcggacggga       240
     attcgtgctg ctttggcaga gaaactggga tgccgtgtac actgttttct taacgatacc       300
     aaggtgattg acgggacccg gcagagcgga gagacccgat cggccctggg aatgcggcag       360
     gcggcagaac attctctttt gaacggagcc gtggttgcca tcggcaatgc tccaaccgcc       420
     ctttttgcgc tcctttcgat gatagaatcg ggccgggtga aaccggcgct tgtggtcggt       480
     attccggtgg gctttgtcgg ggccctcgag tcgaaacagg ccctttacga ttccggttat       540
     ccatgcatta ccaatctgag cgaacgtggt ggaagtccta ttgccgcggc catcgtgaac       600
     ggattgcttt ttcttgccga acaaagggcg gaacagaggg gctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page