(data stored in ACNUC7421 zone)

EMBL: CP002116.PE182

CP002116.PE182       Location/Qualifiers
FT   CDS_pept        191557..192696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0185"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="COGs: COG1903 Cobalamin biosynthesis protein CbiD;
FT                   InterPro IPR002748; KEGG: pth:PTH_0951 cobalamin
FT                   biosynthesis protein; PFAM: cobalamin (vitamin B12)
FT                   biosynthesis CbiD protein; SPTR: Cobalamin biosynthesis
FT                   protein CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD;
FT                   PFAM: CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79342"
FT                   /db_xref="GOA:E1R8J8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J8"
FT                   /protein_id="ADK79342.1"
FT                   /translation="MAQWYDQELGKVSGMRLGITTGSCAQAAARAALEFLLGIFADKRV
FT                   EITLPKGHRRYSGRQILVPVESIGATSDGTGAEALVRKDSGDDPDITDGILIGARVRLK
FT                   EGNGVEIDGAEGVGRITRPGLAGKVGEAAINPIPRRMIREELLPLLPEGKGCRVEIFVP
FT                   EGIALAEKTWNPRIGILGGISIIGTKGVVEPKSEEAYKASINRVIHSYLKSGMSRLIIT
FT                   PGYVGEAFLSSRGIALDRVVTVGDHVGHALLRGADHGAKELLLVGHIGKLTKIAVAMFN
FT                   THWSSGDARLEVIAAYAGAAGASAEKVRRLLSLSLAEEAVALIHDWGLDEIWNAIARRA
FT                   AERTEKLVEGRCTIGVVLLDLKGHSLGSWPKERVEGWLK"
     atggcacagt ggtacgatca ggagttgggg aaggtctcgg gcatgcgtct ggggatcacc        60
     accggcagct gcgcccaggc agcggccagg gccgcccttg aattccttct cggtatcttt       120
     gcggataagc gggtcgaaat cacccttccg aaaggccaca ggcgctacag cggcaggcag       180
     attcttgttc ccgtagagag cataggggcg acatccgacg gaacaggggc cgaggctctg       240
     gtgcgcaagg attcggggga tgatcccgac atcaccgacg gcatactgat cggtgccagg       300
     gttcgtctaa aagaagggaa cggggtcgaa atcgacggcg cagaaggggt tgggcgcatt       360
     acccgaccgg ggcttgccgg caaggtggga gaggcagcta ttaatccgat tccccgaagg       420
     atgatacgag aggagctttt accattgctg ccagagggaa agggctgtcg ggtcgaaatc       480
     ttcgttcccg aagggattgc cctggccgag aagacatgga acccccggat tggcattctg       540
     ggcgggattt cgatcatcgg aaccaagggg gtggtcgagc ccaagtcgga ggaggcctac       600
     aaggcctcca tcaaccgggt gatccacagt tatctgaaaa gcgggatgag ccgtttgatt       660
     atcaccccag gctatgtggg ggaggccttt ctctcttcca ggggcatcgc gttggaccgg       720
     gtggttaccg tgggggatca tgtgggccat gccctgctcc gcggggccga ccatggggca       780
     aaggaactcc ttctggtcgg gcacatcgga aagctgacaa agatcgctgt tgccatgttc       840
     aatacccact ggagcagcgg ggatgccagg ctcgaggtga tcgctgccta tgcaggcgcc       900
     gctggtgcct cggccgagaa ggtccgcagg ctcttgtcgt tgagccttgc cgaagaggcg       960
     gttgccttaa tacacgactg gggcctcgat gaaatttgga acgctattgc ccgccgggct      1020
     gccgagcgga cggagaaact ggtggagggg cgttgtacga tcggcgtcgt gcttctcgat      1080
     ttgaaaggac attccctggg ctcctggcca aaagagcggg tggaaggatg gctgaaatga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page