(data stored in ACNUC7421 zone)

EMBL: CP002116.PE183

CP002116.PE183       Location/Qualifiers
FT   CDS_pept        192693..193367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0186"
FT                   /product="Precorrin-6B methylase 1"
FT                   /note="COGs: COG2241 Precorrin-6B methylase 1; KEGG:
FT                   cac:CAC0584 precorrin-6B methylase 1 CobL1/CbiE; SPTR:
FT                   Precorrin-6y C5,15-methyltransferase (Decarboxylating),
FT                   CbiE subunit; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79343"
FT                   /db_xref="GOA:E1R8J9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J9"
FT                   /protein_id="ADK79343.1"
FT                   /translation="MIHIIGTGPGDGRYTLDLARETIKTCTVFAGFRSHALRFIPPSSP
FT                   FVDLSSDGGVGIYSGLDEIDRLRLGGEDEIGILVSGDPGFHSLLPLVRSRYPQWELRIV
FT                   PGLSAFQVACAKIGIPWQELELVSLHGSGGEDIASFVRRFVSHPPSGMSGFVVLTAGPR
FT                   GDRDLAERIIVEEPRFRGFKAWFCWDIGEDGESIAYCRLDAVQEGGRLCTIIMHRMEEE
FT                   SV"
     atgatccata tcatcggaac gggacccgga gatgggcgtt acaccctcga cctggcccgt        60
     gaaaccataa aaacgtgcac ggtttttgcc ggatttcgga gccacgccct ccgcttcatc       120
     cccccctcaa gcccttttgt cgatctctcc tccgacggag gagttggcat ctattctggg       180
     ctggatgaga tagatcgcct gcgtcttggg ggggaagacg agatcggtat cctggtatcc       240
     ggggaccccg gcttccatag cctgcttccc ctggtccgct cccgttaccc tcagtgggag       300
     ctccgcatcg ttcccggcct aagcgccttt caggttgcct gtgcaaagat cggcattccc       360
     tggcaggagc tggaactggt atccctccac ggcagcggag gcgaggatat cgcatccttt       420
     gtccgcagat ttgtttccca tcccccttcg gggatgagcg gatttgtcgt cctcaccgca       480
     ggcccccgtg gcgaccggga tcttgccgag aggattattg tagaggagcc tcgttttcgt       540
     ggattcaagg cgtggttctg ttgggacatc ggcgaagatg gtgaatcgat cgcctattgt       600
     cgcctggatg ccgttcagga aggtggacgg ctgtgtacga tcattatgca tagaatggaa       660
     gaggagtcag tgtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page