(data stored in ACNUC7421 zone)

EMBL: CP002116.PE185

CP002116.PE185       Location/Qualifiers
FT   CDS_pept        194137..195780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0188"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="COGs: COG1010 Precorrin-3B methylase; InterPro
FT                   IPR006363:IPR002750:IPR000878; KEGG: rca:Rcas_0637
FT                   precorrin-3B C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   cobalamin (vitamin B12) biosynthesis CbiG protein; SPTR:
FT                   Precorrin-3B C17-methyltransferase; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase; PFAM: Cobalamin synthesis G
FT                   C-terminus; Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   Cobalamin synthesis G N-terminal; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79345"
FT                   /db_xref="GOA:E1R8K1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K1"
FT                   /protein_id="ADK79345.1"
FT                   /translation="MKLAALCINEAGKNAAALLAGQMPDLSVVDCSRPGSLAEESARLF
FT                   PLYEGLIFFSAVGIAVRMISGFLRDKYHDPAVVVVDNGCRNAVSLLSGHEGGANRLCWE
FT                   VSRILGCRPVVSTATEARRSIVLGIGTRKDIAASTVAEAVTTALMEAGLSLSDVRIAAT
FT                   IGKKCLEPGLLEALADLDIPLSRVSAREISRFSGAFLPSAAARHIGIPAVAEPCALLAA
FT                   RQGSLIAPLYRRDGVTVAIARERIGPLSISDELSASADLPQVSESINSVNGGSAGEHAG
FT                   GEAEGLPPHRKLHTKGVLYVVGIGPGSPEHMTLAAVRAIEACEVVVGYHRYLELLGELI
FT                   EGKEIFASGMRKEKDRAAAAIDLARTGRIVTVVSTGDAGIYGMAGLILELAGTEAGERF
FT                   DLRIIPGVTAASSAAALLGAPLMHDFAVISLSDLLTEASLIEKRLRLAAEGDFITVLYN
FT                   PKSRSRKALLEKALDSFRACRPLDTPAAVVTNALREGQSVRLESLGSIDADDPDIGMSS
FT                   VVVIGNSSSYRQGRWFITPRGYKIEEPHEG"
     gtgaaactgg ctgccctctg tataaacgaa gcagggaaga acgctgcagc cctccttgcc        60
     gggcagatgc ccgatctgtc tgttgttgat tgcagtcgac caggcagtct cgcagaagag       120
     agtgcacggc tctttcccct ttacgagggg ctcatttttt tctctgcggt ggggatcgcc       180
     gtcaggatga tttccggttt tctccgggat aaatatcacg atcctgcggt ggtggtcgtc       240
     gataacggtt gccgtaatgc ggtgagcctc ctttccggac acgagggcgg tgcaaaccga       300
     ctctgttggg aggtctcccg gatcctgggc tgtcgccccg ttgtgagtac cgctaccgag       360
     gcccggcgct cgattgtact cggtattgga acccgcaagg atatcgctgc atctactgtg       420
     gcagaggccg tcaccaccgc ccttatggag gccggcctct ctctgtcgga tgtcagaatt       480
     gcagccacta tcggtaaaaa atgtctggaa cctggcctcc tcgaggctct cgccgacctc       540
     gacattcccc ttagccgggt aagtgcccgg gagatcagcc gcttctccgg cgcctttctc       600
     cccagtgccg ccgcccggca catcggcatt cccgccgtgg cagagccctg cgccttgctt       660
     gccgccaggc aaggttcctt aatcgccccc ctgtatcgtc gagacggggt gacggttgcg       720
     attgcccggg agcggatagg ccccctttcc atttccgacg agctgtccgc ttcggctgat       780
     ttgccgcaag tgtcagaatc gatcaatagt gtcaatggag ggagcgccgg ggagcatgcg       840
     gggggcgagg ctgaagggct gcccccacac cgtaaactgc acacaaaggg cgtgttgtac       900
     gtggtcggga tcgggccggg ctcgccggag catatgaccc ttgcagcggt tcgggccatc       960
     gaagcgtgcg aggttgtggt tggttaccat cgctatctcg aacttttggg tgagctcatt      1020
     gagggaaagg agatctttgc ttcggggatg cggaaagaga aggatagggc cgccgctgcc      1080
     atcgatcttg cccgaacggg gagaattgtt accgttgtct ccaccgggga tgccggtatc      1140
     tacggtatgg cgggactgat cctggagttg gccgggaccg aagcgggaga gcgctttgat      1200
     ctgcgaatca tccccggggt caccgctgct tcttccgccg ccgccttgct tggtgcgccg      1260
     ctgatgcacg actttgcggt catctcccta agcgatctgc tgaccgaggc ttccctgatc      1320
     gagaaacggc tgcgccttgc cgccgaggga gatttcatca ccgtgctgta taatccgaaa      1380
     agccgaagca gaaaggcctt actggaaaag gctttggact cctttcgcgc ttgtaggccc      1440
     ctggataccc cggctgcggt ggtgacaaac gccctgcgcg agggccaatc ggttcgcctt      1500
     gagagccttg gaagcatcga tgccgatgac cctgatatcg gcatgtcctc ggttgtggta      1560
     atcggcaaca gcagttccta ccggcagggg cgatggttta tcacccccag gggctacaaa      1620
     atcgaggagc cacatgaagg ataa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page