(data stored in ACNUC7421 zone)

EMBL: CP002116.PE186

CP002116.PE186       Location/Qualifiers
FT   CDS_pept        195770..196036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0189"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="COGs: COG2158 Uncharacterized protein containing a
FT                   Zn-finger-like domain; InterPro IPR007212; KEGG:
FT                   dsa:Desal_0255 cysteine-rich small domain protein; PFAM:
FT                   cysteine-rich small domain; SPTR: Cysteine-rich small
FT                   domain protein; PFAM: Cysteine-rich small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79346"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K2"
FT                   /protein_id="ADK79346.1"
FT                   /translation="MKDKRPYSHKFFENRDCRYYPCHQGIEEMNCLFCFCPLYQFPDCG
FT                   GDYRLTADGVKDCTGCIRPHIPENYDLIIAELKRRKSPPGKKK"
     atgaaggata aacgacccta tagccacaaa ttctttgaaa accgcgactg ccgctattat        60
     ccctgccacc aggggatcga agagatgaac tgtcttttct gcttctgccc cctctatcaa       120
     tttcccgact gcggaggaga ttaccgtttg accgccgacg gggtcaagga ttgtaccggc       180
     tgcatcagac ctcacattcc tgaaaactac gatctcatca ttgccgaact caaacggcgg       240
     aaatctcccc ctggaaagaa gaaataa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page