(data stored in ACNUC7421 zone)

EMBL: CP002116.PE188

CP002116.PE188       Location/Qualifiers
FT   CDS_pept        197004..197432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0191"
FT                   /product="PilT protein domain protein"
FT                   /note="InterPro IPR002850:IPR002716; KEGG: cyc:PCC7424_2307
FT                   PilT protein domain protein; PFAM: PilT protein domain
FT                   protein; SPTR: PilT protein domain protein; PFAM: PIN
FT                   domain; TIGRFAM: conserved hypothetical protein TIGR00305"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79348"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K4"
FT                   /protein_id="ADK79348.1"
FT                   /translation="MNAFPVVIDTNVILSGLRFRNGFSFTLLKQIPEKLFTMCISVPLI
FT                   LEYETVLTKHMKQTGLTKEDIGDFIDYTCCVGRRTEIFYLWRPVLKDPFDDHVLELAVA
FT                   SGSRYIISFNKKDFSPARSFGIGVVSPKEFLQSKEEIE"
     atgaatgctt ttcctgttgt cattgataca aatgtcatac tttctggctt gcgttttcga        60
     aatgggtttt catttacttt gctaaagcag ataccggaaa agctatttac catgtgcatc       120
     tctgttccgc ttattctgga gtatgagact gttttgacca agcacatgaa gcaaacgggt       180
     ttgactaaag aggatattgg agatttcatt gattatacat gttgtgtcgg gagacggacc       240
     gaaatatttt atctatggcg acctgtgcta aaagatcctt ttgatgatca tgttcttgaa       300
     cttgctgtgg cctctggaag ccgttatatc ataagcttca acaaaaagga tttttctcct       360
     gcaagaagct ttggaattgg agttgtctct ccaaaggaat ttcttcaatc aaaggaggaa       420
     atagaatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page