(data stored in ACNUC7421 zone)

EMBL: CP002116.PE189

CP002116.PE189       Location/Qualifiers
FT   CDS_pept        197429..197662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0192"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="InterPro IPR002145; KEGG: srm:SRM_00772 hypothetical
FT                   protein; PFAM: CopG domain protein DNA-binding domain
FT                   protein; SPTR: CopG domain protein DNA-binding domain
FT                   protein; PFAM: Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79349"
FT                   /db_xref="GOA:E1R8K5"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K5"
FT                   /protein_id="ADK79349.1"
FT                   /translation="MSSLSIRIPESLHETLKKISKKDRVSINQFIASAVAEKVTALETE
FT                   EYIKVRGEKGTIDKFNNVLSKVKNIEAEENDT"
     atgagttcac ttagtatccg gataccggaa tctctccatg aaaccctaaa gaagatatca        60
     aaaaaggatc gggtatcgat aaatcagttt attgcatcgg ctgttgcaga gaaggtcacg       120
     gcacttgaga ctgaagagta tataaaagta cggggagaga agggcactat tgacaagttc       180
     aataatgtcc tatcaaaggt gaaaaatatt gaggctgaag agaatgatac ctaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page