(data stored in ACNUC7421 zone)

EMBL: CP002116.PE19

CP002116.PE19        Location/Qualifiers
FT   CDS_pept        complement(15219..16184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_3782 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79179"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P7"
FT                   /protein_id="ADK79179.1"
FT                   /translation="MKRVITVMILALLIAVPMFGQIQYSDLESSFATFADDVAEALPFA
FT                   AAATGLTWSDARVKGFPHFGIGLSVSAVTIPKEAFEDVATALGFELPSEITDSSLGVPL
FT                   PGYAVDARLGLPFIPFDIGAKFGYLTPSMGDALEGSTGLTAEYILAGLQVRYPLLKDRL
FT                   LIPAVSVGLGYTYLNGSVAMETTGMANQIDFPGGETLNIGNPDAVFAWKTHAIDLSVQA
FT                   SKSLLILTPYLGAGYSYGWSRAGGGVNADITGDVDAVEDNYDVEITDDGFVVYSDASGG
FT                   SFRAFGGLSFNLTILKLDLNAQYNFTTQSLGGGLNARIQI"
     atgaaaagag tcattacagt gatgatcctg gccctgttga tagcagtgcc gatgtttggg        60
     caaatacaat attccgatct tgaatcatcc tttgccacct ttgccgatga tgttgccgag       120
     gcactgccgt tcgcggctgc ggctaccggc ctcacctggt cggatgccag ggtaaagggc       180
     ttcccccact tcggtatcgg cctttcggta tcggcggtta ccattccgaa ggaggccttc       240
     gaagatgttg caactgctct aggctttgag cttccaagcg aaataactga ttccagtctg       300
     ggagttcccc tgcccggcta cgctgtcgac gcacgattgg ggcttccttt tatccccttc       360
     gacattggcg caaaattcgg ttatctcacc ccttcaatgg gtgatgccct cgaaggttca       420
     accggcctta ccgccgaata tatcctggca ggtcttcagg ttcgttatcc ccttcttaaa       480
     gaccgtctgc ttattcccgc agtcagcgtg ggactcggct atacctacct caacggctcg       540
     gttgccatgg aaaccacggg aatggcaaat cagattgact ttcccggcgg agaaactctc       600
     aatataggta atcccgatgc cgtctttgca tggaagaccc atgcaatcga cctctcggtc       660
     caggcaagca aatccctgct catcctcacc ccctatctcg gggcaggcta ctcctacggc       720
     tggtcgcggg ccggcggagg tgttaatgca gatataaccg gagacgtaga tgctgtggaa       780
     gataattatg atgtggaaat caccgacgac ggttttgtgg tctactccga tgccagcggc       840
     ggatctttca gggcattcgg cgggctaagc ttcaatctga cgatactgaa actggacctg       900
     aacgcccagt acaactttac cactcagtcc ctaggcggcg gtctgaacgc ccgtatccag       960
     atctaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page